Conserved Protein Domain Family
PRK09362

?
PRK09362: PRK09362 
phosphoribosylaminoimidazole-succinocarboxamide synthase; Reviewed
Statistics
?
PSSM-Id: 181800
View PSSM: PRK09362
Aligned: 572 rows
Threshold Bit Score: 244.245
Threshold Setting Gi: 171186350
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
283783481   1 MEKLEKLYEGKAKKLYATDDTNVLWVEYMNQATAGNGLKKAQIAGKGSLNNRITSLLFHLLEARGVKSHFLGRISDTEQL 80 
209396021   1 MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSKLAEAGIPTQMERLLSDTECL 80 
254794421   1 MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSKLAEAGIPTQMERLLSDTECL 80 
260856571   1 MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSKLAEAGIPTQMERLLSDTECL 80 
291283696   1 MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSKLAEAGIPTQMERLLSDTECL 80 
170019239   1 MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSKLAEAGIPTQMERLLSDTECL 80 
260845110   1 MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSKLAEAGIPTQMERLLSDTECL 80 
187731713   1 MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSKLAEAGIPTQMERLLSDTECL 80 
110806409   1 MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSKLAEAGIPTQMERLLSDTECL 80 
56480114    1 MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNYFIMSKLAEAGIPTQMERLLSDTECL 80 
283783481  81 VKRMRMFPLEIIMRNTAAGSFAKRYNVKEGTPLKKPLLEFCVKSDELGDPFINPEGVVALGLATDEEMAEVTRQAHAVNN 160
209396021  81 VKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKAND 160
254794421  81 VKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKAND 160
260856571  81 VKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKAND 160
291283696  81 VKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKAND 160
170019239  81 VKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKAND 160
260845110  81 VKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKAND 160
187731713  81 VKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKAND 160
110806409  81 VKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKAND 160
56480114   81 VKKLDMVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAMHDPMVNESYCETFGWVSKENLARMKELTYKAND 160
283783481 161 ALLDIFSKIDVQLVDFKIEEGVDAqGNILLADEITPDTCRLWDKRNagtngVSHLDKDLFRRDLGDIIPAYEEIYDRLAS 240
209396021 161 VLKKLFDDAGLILVDFKLEFGLYK-GEVVLGDEFSPDGSRLWDKET-----LEKMDKDRFRQSLGGLIEAYEAVARRLGV 234
254794421 161 VLKKLFDDAGLILVDFKLEFGLYK-GEVVLGDEFSPDGSRLWDKET-----LEKMDKDRFRQSLGGLIEAYEAVARRLGV 234
260856571 161 VLKKLFDDAGLILVDFKLEFGLYK-GEVVLGDEFSPDGSRLWDKET-----LEKMDKDRFRQSLGGLIEAYEAVARRLGV 234
291283696 161 VLKKLFDDAGLILVDFKLEFGLYK-GEVVLGDEFSPDGSRLWDKET-----LEKMDKDRFRQSLGGLIEAYEAVARRLGV 234
170019239 161 VLKKLFDDAGLILVDFKLEFGLYK-GEVVLGDEFSPDGSRLWDKET-----LEKMDKDRFRQSLGGLIEAYEAVARRLGV 234
260845110 161 VLKKLFDDAGLILVDFKLEFGLYK-GEVVLGDEFSPDGSRLWDKET-----LEKMDKDRFRQSLGGLIEAYEAVARRLGV 234
187731713 161 VLKKLFDDAGLILVDFKLEFGLYK-GEVVLGDEFSPDGSRLWDKET-----LEKMDKDRFRQSLGGLIEAYEAVARRLGV 234
110806409 161 VLKKLFDDAGLILVDFKLEFGLYK-GEVVLGDEFSPDGSRLWDKET-----LEKMDKDRFRQSLGGLIEAYEAVARRLGV 234
56480114  161 VLKKLFDDAGLILVDFKLEFGLYK-GEVVLGDEFSPDGSRLWDKET-----LEKMDKDRFRQSLGGLIEAYEAVARRLGV 234
283783481 241 LAQ 243
209396021 235 QLD 237
254794421 235 QLD 237
260856571 235 QLD 237
291283696 235 QLD 237
170019239 235 QLD 237
260845110 235 QLD 237
187731713 235 QLD 237
110806409 235 QLD 237
56480114  235 QLD 237
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap