Conserved Protein Domain Family
PRK09352

?
PRK09352: PRK09352 (this model, PSSM-Id:181792 is obsolete and has been replaced by 236475)
3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Statistics
?
PSSM-Id: 181792
View PSSM: PRK09352
Aligned: 628 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
184200724  11 AHTRILGIGAYRPSEIVTNDDVCQWIESSDEWIVKRTGIHTRHRAPEDVSVLDMAEHAAREALENSGLTGEQLSTIIVST 90 
15604605    1 MTCKIIGSGGYLPPKIISNDELTKFVDTNDKWIRTRTGILQRHIAGDAEYTSHLAFKSAQKAIEDAMISVDDIDLIIICT 80 
51473940    1 MTCKIIGSGGYLPQKIISNDELTKFVDTNDKWIRTRTGIFQRHIAGDTEYTSHLALKSAQKAIEDAMISVDDIDLIITCT 80 
91204943    1 MTCKIIGCGGYLPPKVVSNDELAKFVDTNDEWIRTRTGISQRHIAGDTEYTSHIALKAAEKAIADADISVNEIDLIITCT 80 
157827729   1 MTCKIIGCGGYLPPKVVSNDELAKFVDTNDEWIRTRTGISQRHIAGDTEYTSHIALKAAEKAIADADISVNEIDLIITCT 80 
288818116   1 MGTTLTGIGYYLPPKVLTNFDLEKMVDTSDDWITTRTGIKERRIA-DNENVTQMAYMASLEALESANIQPEDIDLIILAT 79 
15606369    1 MGTKIIGTGVYLPKNVLTNFDLEKIVDTSDEWITTRTGIKERRIAKE-ETITYMATQAAKEALREANLSPEELDLIILAT 79 
188996759   1 MSSEIKGIGMYVPERVLTNHDLEKILDTSDEWITTRTGIKERRIADEWVKASDLAFHASKEAIENAGLTPKDIDIVIVAT 80 
225849366   1 MGSKITGLGMYIPERVLTNFDLEKILDTSDEWITTRTGIKERHIADEWVKASDLALHSSKEAIEMAGISPKDIDVILVAT 80 
289548672   1 MGTTIVGLGFYVPHHVLTNFDLEKMVDTSDQWITTRTGIKERRIA-RDEDLVDMAQKASVKALQMAGVEPNQLDAILVAT 79 
184200724  91 VSFPYLTPSLAANLADRLGATPAAAYDISAACAGYCYGVAQADSLVRSGDSTNVLVIGVEKLSDVIDNHERSISFLLGDG 170
15604605   81 TTPDNSFPSVATKLHGYLGLTNIPSFDLQAVCAGFIYGLQLAHSLIVSGKYKTILLIGAEKMTSLLDWNDRSTCVLFGDG 160
51473940   81 TTPDNSFPSVATKLHGYLGLTNIPSFDLQAVCAGFIYGLQLTNSLIVSGKYKTILLIGAEKMTSLLDWNDRSTCVLFGDG 160
91204943   81 TTPDNSFPSVATKLQGYLGLNNVPSFDLQAVCAGFVYGVQVANSLISSGKYKTILLIGAEKMTSLLDWEDRATCVLFGDG 160
157827729  81 TTPDNSFPSVATKLQSYLGLNNVPSFDLQAVCAGFVYGVQVANSLISSGKYKTILLIGAEKMTSLLDWEDRATCVLFGDG 160
288818116  80 LTPELKFPSTACLLQAKLGAKRAYAFDISAACSGFIYGLELADAYIKSGKAKKILLVGVEKLSEIVNWQDRSTCVLFGDG 159
15606369   80 LTPQKRFPSTACLVQAQLKAKGVYAFDISAACSGFIYALDIADSFIKSGKAKNVLVIGAEKLSEAVDWEDRSTCVLFGDG 159
188996759  81 STPDNVFPSTACILADKLGCKNPMAFDFSAACSGFIYGITIADSFIKSGKAENILVVGSEVFSKIIDWTDRTTAVLFGDG 160
225849366  81 STPDMIFPSTACFLSDKLGCKNPMAFDFSAACSGFIYGLTIADSFIKSGKANHVLVVGSEVFSKIIDWSDRTTAVLFGDG 160
289548672  80 ITPPLGFPAAACLLQQRIEAQRAYALDISAACSGFLYGLELADALITSGKAKKVLLVGAEKLSQIVDWQDRSTCVLFGDG 159
184200724 171 AGAVVIGPSeV-P-GIGPSVWGSDGSKWDairmthpLTdIRTVERGGQRTfakdlvdpetgemdpdatlwP-TLRQDGQT 247
15604605  161 AGSVILQRS-NdDsGLIDSNIFSSGTDYE-------IL-YTSGGTSMNGT--------------------SgKIVMQGQK 211
51473940  161 AGSVILQRS-NdEsGLIDSNIFSSGTDYE-------IL-YTSGGTSMNGT--------------------SgKIVMQGQK 211
91204943  161 AGSVILQRS-DdNsGIIDSNIFSSGADYE-------IL-YTNGGVSMNGS--------------------SgKIIMQGQK 211
157827729 161 AGSVILQRS-DdNsGIIDSNIFSSGADYE-------IL-YTNGGVSMNGS--------------------SgKIIMQGQK 211
288818116 160 AGAVIISEG-D-G-EVLSSKMLSDGELWE-------IL-YAPKCG---------------------------YINMKGKE 201
15606369  160 AGAVVVTRS-EdKsDILATRMYAEGSLEE-------LL-HAd---------------------------nCgYIRMKGRE 203
188996759 161 AGAVVISKS-NsSsDILSTVMKSDGSYGH-------LL-HCq---------------------------vGeKLRMQGRE 204
225849366 161 AGSVVLSKS-DdSsDILSTVMKSEGSHWQ-------LL-HCq---------------------------vGeKLRMQGRE 204
289548672 160 AGAVVLSQG-E-G-GVLSSTLRSDGNFWE-------IL-YAPKCG---------------------------SIKMKGRE 201
184200724 248 VFRWASWEGARVAQEALDAAGLAPEDLAAFVPHQANMRIIDQMAKVLKLPESvIIARDIAEAGNTSAASIPLATHRLLAE 327
15604605  212 LFRHAIEKMLQSIEDLLYANQFSVSDIDYFIPHQANIRIINKLAELLNIEEH-KVVKTVEKHANCSAASIPLALSALKES 290
51473940  212 LFRHAIAKMLQSIEDLLHANQFSVSDIDYFIPHQANIRIINKLAELLNIEEH-KVVKTVEKHANCSAASIPLALSTLKES 290
91204943  212 LFRLAVEKMHQSIEELLRNNNFTVNDIDYFIPHQANVRIINKLAELLNVEDH-KVVKTVEKHANCSSASIPLALSTLKAS 290
157827729 212 LFRLAVEKMHQSIEELLRNNNFTVNDIDYFIPHQANVRIINKLAELLNVEDH-KVVKTVEKHANCSAASIPLALSTIKAS 290
288818116 202 LFKLAVRSMEEVCRYVLESAGISIEDVSIMIPHQANIRIMEALAEKLGMPKE-KVYSNIHKYGNTSAASIPIAMYEAYKE 280
15606369  204 LFKVAVRSMEEVCREVLEKAGVKPEEVSLVIPHQANVRIINALAEKLNIPKE-KVFVNIQKYGNTSAASIPIALHEAIKE 282
188996759 205 TFKQAVKSMETACLKALQKAGINKEDIKLVIPHQANIRIIQALAEKLELPLE-KVYSNIHEYGNTSAASIPIAIYEAYKE 283
225849366 205 TFKHAIKSMEQACNKALAKAGLTKNDIKLVIPHQANVRIIDALAEKLEIPKE-KVYVNIHKYGNTSAASIPIAMYEAYKE 283
289548672 202 LFRLAVRSLEEASLEALEKAGLKPQDIDLFVPHQANVRIIEAVAEKLSIPKE-KIYINIDRYGNTSAASIPIALSEAYAE 280
184200724 328 HPELSGKPSLQIGFGAGLVYGAQVVLL 354
15604605  291 GKIKKGDILLFSAIGAGLTWGGALIRW 317
51473940  291 GKIKKGDILLFSAIGAGLTWGSALIRW 317
91204943  291 GKIKKGDIILFSAIGAGLTWGSALLRW 317
157827729 291 GKIKKGDIILFSAIGAGLTWGSALLRW 317
288818116 281 GKLRRGDIVMLTAMGGGLTWGAMLLRF 307
15606369  283 GKVKRGDLILMTAMGGGLTWGAVLLRY 309
188996759 284 GRFNKGDYILLTAFGGGLTWGAAVIRF 310
225849366 284 GRINRGDYILLTAFGGGLTWGAVVIRF 310
289548672 281 GRLRRGDTVLLAAMGGGLTWGAMVIRF 307
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap