Conserved Protein Domain Family
PRK09258

?
PRK09258: PRK09258 
3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Links
?
Statistics
?
PSSM-Id: 181732
View PSSM: PRK09258
Aligned: 69 rows
Threshold Bit Score: 448.56
Threshold Setting Gi: 258654362
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
296123557   1 MRYSKVFIETIGYELAPEVVSSVELEERLAPVYEKLKVSPGQLEAWTGISERRWW-PEGYKLTSGATAAARRALEQSNVS 79 
219847490   1 MLFKHVMIEAVSYVLAPHRITSAWIEDQIAETMERLRFPRGKLEALSGIRERRFW-DEGTLPSTVATMAAEQLLQQVSVD 79 
222527027   1 MLFRHVMIEAVSYVLAPHRITSDWIEDQIAETMERLRFPRGKLEALSGIRERRFW-DEGTLPSTVATMAAERLLDQVAID 79 
163849058   1 MLFRHVMIEAVSYVLAPHRITSDWIEDQIAETMERLRFPRGKLEALSGIRERRFW-DEGTLPSTVATMAAERLLDQVAID 79 
284990951   7 HRFGNTAVLALQTTDATRVVTSDALDDALADTYRRVGLRPGLLERLAGIRERRWW-GEGVTFVDGAAEAGAKAISESGVD 85 
152965648  23 FAPANAALLSISHVEAPQVVPSSYFDEVLSGTLERLRLRPGLLEKVAGVRERRWW-AEGQKASDVAAECGAKALSEAGVD 101
257068902   8 IVHANTSLLAVEMTLPQVTVTSDEIDEMLSPARKRLRLPKGVLQRVAGVYERRWWrDRENGWKQGVVLAAERAMAKAGIM 87 
258654362   7 FRFHDVAILSLDAGPAPLVVTSADVDRRLAPFYARTRSMSGLVTSLAGDFERRQW-PAEVSFIQAAARAGEAAIAAAGID 85 
184200698   7 IRNRNAAVLSVTRTEADVVIPSTRFDEELAHTFKRLRLPKGLLERLAGIRERRGW-APGRHFTDGATEAGQAALEQSGIR 85 
256824580   7 FRHSNTSVLSVTALPAPEVHTSAEFDARIMDTLRRNKLVPGVLSRLVGIKERRWW-PEDVHFTEAAAEAGRRALVDAGIK 85 
296123557  80 TRDLGVLIYAGVCREQFEPATACGVAANLRLTDDVAVYDLSNACLGVLNGIIDIANRIELGQIRAGMVVSCESAREIIEF 159
219847490  80 RDRIGLLINTSVCQDYLEPSTACFVHRNLGLSPRAINFDVRNACLGFLNGMAIAGMMIEAGTIEYALIVDGEGSQDAVMA 159
222527027  80 RERIGLLINTSVCQDYLEPSTACFVHRNLGLSPRAINYDVRNACLGFLNGMAIAGMMIEAGTIEYALIVDGEGAQDAVMA 159
163849058  80 RERIGLLINTSVCQDYLEPSTACFVHRNLGLSPRAINYDVRNACLGFLNGMAIAGMMIEAGTIEYALIVDGEGAQDAVMA 159
284990951  86 PAGIGVMINTSVSRRWLEPSTAVAVHHALGLPRSCQNFDVTNACLGFVNGMELAAAMIDAGLVEHALVVNGEDAQPVQER 165
152965648 102 ASEVGVVISTTVTRPHLEPAVATSVHHGMDLPPSAMNFDIANACLAWVNGVQVASAMIDSGMIRYAVVLGAEDVRSMHEG 181
257068902  88 RDQVGLLINASVSRQHLEPAVSTGIHHSLGMPSSCMNFDITNACLGFVNAMAMAAGMIDSGQIKYALIVGAEDVEEVQRG 167
258654362  86 RARIGVVIDTSVSRARLEPSSAVSVHHLLDLPPNCLNFDVSNACLGFVTGLHLAGALIDSGQIDYALIVDGEGTREIYDR 165
184200698  86 PEQIGLFINASVTRDNYEPAVAVGIHERLGLPSSALNFDMTNACLGFVNALTVASSMIDAGAIEYALVVAGEDPSPWHEA 165
256824580  86 PEQVGLMVNTSVSRDHLEPSTAVRIHDTLGLPRSASNFDVTNACLGFVNGMQIAAAMIDSGQIEYALIVNAETTRHTHET 165
296123557 160 TIQRLLEDPTM-ENLTHSLATLTGGSGAVAVILTDGSFsRARGHKLLGGSLLAAPEHHELCRWGfesllpaavnkveqvl 238
219847490 160 TIRRLRRPETTkQDLRDNFATLTLGSGGAAMLLTHECL-SRSGHRLNGVVTLAATQYNHLCLGQ---------------- 222
222527027 160 TIRRLRRPETTkQDLRDNFATLTLGSGGAAMLLTHERF-ARNGHRLNGVVTLAATQYNHLCLGQ---------------- 222
163849058 160 TIRRLRRPETTkQDLRDNFATLTLGSGGAAMLLTHERF-ARNGHRLNGVVTLAATQYNHLCLGQ---------------- 222
284990951 166 TLDRLNQPGTGsKDVIAQFATLTLGSGAAAMVLGRADR-HPEGHRLVASVSRAGTEHHELCVGD---------------- 228
152965648 182 TIARLQREGITrKDFLNEFATMTLGCGAAAAVIGRADE-HPEAHRIVGGVSRAGTAHHELCIGD---------------- 244
257068902 168 TIDRINAKNSTrDDFNNQFASLTLGSGAAAAVLGPADE-HPEGHRLKVTQARAGTEHHELCVAN---------------- 230
258654362 166 TIDRLNERGEGlPDLLANFATFTLGSGAAAMVLGRHSA-HPEGHQLLDGFFRAETRHHELCIGT---------------- 228
184200698 166 AIARLREDDITrEQVVQEFATLTLGCGAAAAVVGPADR-HPDGHRIVGSVTRAGTEFSRLCIGG---------------- 228
256824580 166 TLKRLESEDATaDDVLQQLATLTLGSGAAAMVLGRTDK-HPEGHRFVGGVSRAGTEHHELCVGD---------------- 228
296123557 239 psavtqtrlgslmpqlvqqkvsgilpaklshafHQFMQTDSISVMKYGVELGVKTWAS-MLARFGLKPQEIDKVICHQVG 317
219847490 223 ---------------------------------PDYMKTDAGALMHAGVELATATWRLaQETLPNWSDRQIALYAPHQVG 269
222527027 223 ---------------------------------PDYMKTDAGALMHAGVELAVDTWRLaQEVLPNWSDRQIALYAPHQVG 269
163849058 223 ---------------------------------PDYMKTDAGALMHAGVELAVDTWRLaQEVLPNWSDRQIALYAPHQVG 269
284990951 229 ---------------------------------NDLMRTDLKGLLDAGLALSEDMWAD-AAAEVDWAGG-MSRYIVHQVS 273
152965648 245 ---------------------------------MNHMKTDAKLMLTEGIEIVVDAFNA-GDELWGWRD--AEKFVIHQIS 288
257068902 231 ---------------------------------MQDMRTDSAGLLENGIGLIVDTWKG--ANDAGLDFKSIDYVIPHQVS 275
258654362 229 ---------------------------------IDGGVTDSRALLEAGIELAGAAWAQ-AGATAAWGS--RDRYIFHQVS 272
184200698 229 ---------------------------------GDGMFTDATGLLNHGVGLVVEAWLD--AERDGWDWREMDSYVTHQVS 273
256824580 229 ---------------------------------FDRMTTDSVGLQEAGIALSEELWAE-AAEEFDW--QHLDRYVIHQVS 272
296123557 318 KGHREQVLKSLGIPLEKDFPTFPFLGNMGTVSLPMTASLAEERGFLKKGDRVAFLGIGSGLNCLMLAVDW 387
219847490 270 ARHMAAVTKALGITPSKLFLNFPTLGNIGPAALPISLAQAVEAGRLRPGDHVGLLGIGSGLNCSMMSVTW 339
222527027 270 ARHMAAVTKALHITPSKLFLNFPTLGNVGPAALPISLAQAAEAGRLRAGDHVGLLGIGSGLNCSMMSVTW 339
163849058 270 ARHMAAVTKALHITPSKLFLNFPTLGNVGPAALPISLAQAAEAGRLRAGDHVGLLGIGSGLNCSMMSVTW 339
284990951 274 KVHTQAMCDRFSIDPALVPTTFPTRGNLGPASVPYTLAGEQDS--LVDGDRVLLMGIGSGLNVSCLELAW 341
152965648 289 KVHTETLVERIGVDAAKVPMTFPQWGNVGPISLPMTLAATAPE--LSPGDRVIAMGVGSGLNTAMLELQW 356
257068902 276 MVYTRNFSKITGVGMERIPVTFPDWGNIAAEAVPMTLAHIQDQ--VQCGQRVLLMGVGSGLNTAMMEVQW 343
258654362 273 EVHTKAMIRTLGVDPAKVPTTFARYGNIGPAAIPITLATVADE--LSPGDIVLCMGIGSGLNVGVIELRW 340
184200698 274 NSHTNKLIEDMGIDAAKVPLTFPYWGNVAAAALPMTLALEAER--LEPGARVLCLGVGSGLNTTLMEIAW 341
256824580 273 TVHTEQICDRLGLDGAKVPRTFPTYGNMGPAAVPFTLALEAPH--LERGDRVLLMGIGSGLNACCAEIEW 340
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap