Conserved Protein Domain Family
PRK09059

?
PRK09059: PRK09059 
dihydroorotase; Validated
Statistics
?
PSSM-Id: 181631
View PSSM: PRK09059
Aligned: 44 rows
Threshold Bit Score: 744.548
Threshold Setting Gi: 154247841
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 227821658   1 MTRPLVLQNLRIVDPSRNLDETGTIVVgNDGRILAAGKDAMNQGVPAGAFVKDCAGLTAVPGLVDARVFVGEPGSEYRET 80
gi 27380211    7 DRRPILLANARVVDPSRDFDGPGDVLI-ADGIIRETRRGIGAAGVPEGTDVVNCAGKIVAPGLIDMKAFVGEPGFSHRET 85
gi 92117806    4 GNRPILLANARIVDPARDLDGPGDVLI-ADGVVRDARRDIAAAGVPEGTDIINCAGKIVAPGLIDIRAFVGEPGAGHRET 82
gi 75676198    4 GHRPILLANARIVDPARDLDGPGDVLI-ADGVIRDARHGIGAAGAPEGTDIINCAGMIVTPGLIDIRAFVGEPGAGHRET 82
gi 39936181    4 DRRPILLANARLIDPSRDFDGIGDVLI-ADGVIRDARRGIGAAGVPEGTDIVNCAGMVVAPGLVDMRAFVGEPGASHRET 82
gi 115525375   4 DRRPILLANARLIDPSRDFDGIGDVLI-ADGAIREARRGIGAAGVPEGTDIINCAGKVVTPGLIDMRAFVGEPGASHRET 82
gi 90423749    8 DRRPILLANARLIDPSRDVDGIGDVLI-ADGTIREARRGIGAAGVPEGTDIINCAGKIVAPGLIDMRAFVGEPGAGHRET 86
gi 91977497    4 DRRPILLANARLIDPARDFDGVGDVLI-ADGVIRDARRGIGAAGVPEGTDIINCGGMIVAPGLIDMRAFVGEPGASHRET 82
gi 86749543    4 DRRPILLANARLIDPARDFDGLGDVLI-ADGVIRDARRGIGAAGVPEGTDIINCAGMVVAPGLVDMRAFVGEPGASHRET 82
gi 192291898   4 DRRPILLANARLIDPSRDFDGIGDVLI-ADGVIRDARRGIGAAGVPEGTDIVNCAGMVVAPGLVDIRAFVGEPGASHRET 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 227821658  81 IESASRAAATGGVTSFIAMPDTNPVIDEIALVEFVQKTARDKALVNVHPAAALTKGLLGAEMSELGLLRDAGAVCFTNGR 160
gi 27380211   86 FASASQAAATGGITTIICQPDTEPVIDNSATVDFVMRRARDTAIVNIQPMAALTKGMRGEEMTEFGLLKAAGAIAFSDGD 165
gi 92117806   83 FASASRAAAAGGITTIVCQPDTSPVIDNSATVDFVLRRARDTAIVNIHPMAALTKGLAGKEMTEIGLLKAAGAVAFTDGA 162
gi 75676198   83 FASASCAAAAGGITTIVCQPDTSPVIDNSATVDFVLRRARDTAIVNIHPMAALTKGLAGKEMTEFGLLKEAGAVAFTDGA 162
gi 39936181   83 FASASQAAAAGGITTIVCQPNTSPVIDNSATVDFVMRRARDTAIVNIHPMAAITKGLAGAEMTEIGLLKAAGAVAFSDGD 162
gi 115525375  83 FASASQAAAAGGITTIICQPDTSPAIDNSATVDFVLRRARDTAIVNIHPMAALTKNLAGAEMTEIGLLKAAGAVAFTDGD 162
gi 90423749   87 FASASQAAAAGGITTIICQPDTSPTIDNSATVDFVLRRARDTAIVNIHPMAALTKDLAGHEMTEIGLLKAAGAVAFTDGV 166
gi 91977497   83 FASASQAAAAGGITTIICQPNTSPVIDNSATVDFVMRRARDTAIVNIHPMAALTKGLAGAEMTEIGLLKAAGAVAFSDGD 162
gi 86749543   83 FASASQAAAAGGITTIICQPNTSPVIDNSATVDFVMRRARDTAIVNIHPMAALTKGLNGIEMTEIGLLKAAGAVAFSDGD 162
gi 192291898  83 FASASQAAAAGGITTIVCQPNTSPVIDNSATVDFVMRRARDTAIVNIHPMAAITKGLAGAEMTEIGLLKAAGAVAFSDGD 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 227821658 161 QPVHDSLVLRRAMTYAREFDAVVALETRDKYLGAnGVMNEGLLASWLGLPGIPREAEIIPLERDLRIAALTKAAYHAAEV 240
gi 27380211  166 RSVTNAQVMRRALTYARDFDALIVHHTEDPDLVGeGVMNEGEFASRLGLMGIPNAAEAVMLERDMRLVALTGGRYHAASL 245
gi 92117806  163 RSVMNARVMRRALTYARDFDALIVHHTEDAHLVGeGVMNEGELSARLGLMGIPAAAEAMVLERDMRLVALTGGRYHAASL 242
gi 75676198  163 RSVMNAQVMRRALTYARDFDALIVHHTEDAHLVGdGVMNEGELSSRLGLTGVPATAEAVMLERDMRLVGLTGGRYHAASL 242
gi 39936181  163 LSVTNAQVMRRALTYARDFDALIVHHTEDPDLVGeGVMNEGEFATRLGLAGIPNAAETVMLERDIRLVMLTGGRYHAASL 242
gi 115525375 163 RSVMNAQLMRRALTYARDFDALIVHHTEDPNLVGeGVMNEGEFASRLGLIGVPNTAEAVVLERDMRLVALTGGRYHAASL 242
gi 90423749  167 RSVMDAQVMRRALTYARDFDALIVHHTEDPNLVGeGVMNEGELASRLGLIGVPNIAEAVVLERDMRLVALTGGRYHAASI 246
gi 91977497  163 RSVMNARVMRSALTYARDFDALIVHHTEDPDLVGeGVMNEGEFATRLGLSGMPNAAEAVVLERDVRLAALTGGRYHAASL 242
gi 86749543  163 RSVMNARVMRSALTYARDFDALIVHHTEDPDLVAeGVMNESEFATRLGLSGVPSAAEAVVLERDVRLAALTGGRYHAASL 242
gi 192291898 163 LSVTNAQVMRRALTYARDFDALIVHHTEDPDLVGeGVMNEGEFATRLGLAGIPNAAETVMLERDIRLVMLTGGRYHAASL 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 227821658 241 SLPESADAVQAARERGANVTCGISINHLTLNENDIGEYRTFFKLSPPLRGEDDRVAMVEALATGKIDIIVSSHDPQGADT 320
gi 27380211  246 SCIDSLDILKRARDAGLAVSASVSINHLALNENDIGPYRSFLKLSPPLRTEDDRRALVAAVASGLIDVIMSDHNPQDVEV 325
gi 92117806  243 TCAESLDILKRARDAGLRVTASASINHLTLNENDIGPYRTFLKLSPPLRSEDDRRALVVALASGLIDVVMSDHNPQDVET 322
gi 75676198  243 TCAESLDILMRARDAGLPVSASASINHLTLNENDIGPYRTFLKLSPPLRGEDDRRALVAALASGLIDVVMSDHNPQDVET 322
gi 39936181  243 TCIESLEIMQRARDLGLSVSASVSINHVALNENDIGPYRTFLKLAPPLRTEADRKALIAAIASGLIDVVMSDHNPQDVEV 322
gi 115525375 243 TCVDSIEILKRARDAGLRVTASASINHLTLNENDIGPYRSFLKLSPPLRTETDREALVSALASGVIDVIMSDHNPQDVEV 322
gi 90423749  247 TCVESIEILRRAREAGLKVTASASINHLTLNENDIGPYRSFLKLSPPLRTEDDRQALVAAVAAGLIDVIMSDHNPQDVEV 326
gi 91977497  243 TCIESLEILQRARDTGINVSASVSINHVSLNENDIGPYRTFLKLSPPLRTENDRKALIAAVASGLVDVIMSDHNPQDVEV 322
gi 86749543  243 TCIESLEILQRARDAGINVSASVSINHVTLNENDIGPYRTFLKLSPPLRSEDDRKALIAAVSSGLIDVIMSDHNPQDVEV 322
gi 192291898 243 TCIESLEIMQRARDLGLSVSASVSINHVALNENDIGPYRTFLKLAPPLRTEADRKALIAAIASGLIDVVMSDHNPQDVEV 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 227821658 321 KRLPFADAADGAIGLETLAAAALRLYHSGQVPLMRLIDALSTRPAAIFGLDAGTLKPGAKADITVLDLDEPWILYEKELV 400
gi 27380211  326 KRLPFAEAAPGAVGLETMLPAGLRLMHNGELDLKTLIQAMSTRPAEILGLPGGTLRAGSPADVIVIDPDVPWVVDPAELK 405
gi 92117806  323 KRLPFAEAAAGAIGLETMLTAALRLVHNAELDFKTLIRAMSTRPAELLGLPGGSLRPGAPADVIVIDPDTPWILDPADLK 402
gi 75676198  323 KRLPFAEAAAGAIGLETMLTAALRLVHNAELDFKTLIRAMSTRPAELLGLPGGSLRPGAPADVIVIDPDVPWILDPADLK 402
gi 39936181  323 KRLPFAEAAAGAIGLETMLPAGLRLVHAGELDFLSLIRAMSTRPAELLGLPGGTLRSGAPADLIVIDPDVPWLVDPDELK 402
gi 115525375 323 KRLPFAEAAAGAIGLETMLSAGLRLVHSGELSLLALIRAMSTRPAELLNLPGGTLRAGSPADLIVIDADVPWVVDPTELK 402
gi 90423749  327 KRLPFAEAAAGAIGLETMLPAGLRLIHSGELDFLTLIRAMSTKPAELLGLPGGTLRAGSPADLIVIDADVPWVVDPNELK 406
gi 91977497  323 KRLPFAEAAAGAIGLETMLPAGLRLVHNGELDLLTLIRAMSTRPAELLGLPGGTLRAGSPADLIMIDIDTPWVVDPNELK 402
gi 86749543  323 KRLPFAEAAAGAIGLETMLPAGLRLLHAGELDLLSLIRAMSTRPAELLGLPGGTLRAGSPADLIVIDLDTPWIVDPNELK 402
gi 192291898 323 KRLPFAEAAAGAIGLETMLPAGLRLVHAGELDFLSLIRAMSTRPAELLGLPGGTLRSGAPADLIVIDPDVPWLVDPDELK 402
                        410       420       430
                 ....*....|....*....|....*....|
gi 227821658 401 SRSKNTPFENARFTGRVVQTYVGGKLVHSS 430
gi 27380211  406 SPCKNTPFDEARFTGRVVRTIVGGRTVFEH 435
gi 92117806  403 SQCKNTPFDESRFSGRVVRTIVGGRTVFEH 432
gi 75676198  403 SQCKNTPFDESRFSGRVVRTIVGGRTVFEH 432
gi 39936181  403 SKCKNTPFDEARFSGRVIRTIVGGRTVYEH 432
gi 115525375 403 SKCKNTPFDEAKFSGRVARTIVGGRTVYEH 432
gi 90423749  407 SKCKNTPFDEAKFAGRVARTIVAGRTVYEH 436
gi 91977497  403 SKCKNTPFDEARFSGRVTRTIVGGRTVYEH 432
gi 86749543  403 SKCKNTPFDEARFSGRVVRTIVGGRTVYEH 432
gi 192291898 403 SKCKNTPFDEARFSGRVIRTIVGGRTVYEH 432
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap