Conserved Protein Domain Family
PRK07515

?
PRK07515: PRK07515 (this model, PSSM-Id:181012 is obsolete and has been replaced by 236037)
3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Statistics
?
PSSM-Id: 181012
View PSSM: PRK07515
Aligned: 89 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
296113083   1 MGIYLTATGLYKPAYQISNDELVAAFNTYVDNYNAEHAKAIAAGDKVALQHSSSEFIEKASGIKSRYVIDKKGILDPKIM 80 
119774647   3 QSIAITGTGVFTPPEGIDNDALVASFNAYVDLFNREHEGQIDLGHIEPLAYSSSEFIEKASGIKHRYVMVKDGILDPEIM 82 
91793871    3 KKVVISGSGLFTPPYSVSNQELVSSYNAYVDQFNLAHQTEIKEEKIAPLAHSSSEFIEKASGIQNRYVMVKEGILDPNVM 82 
196158083   5 QQVVISGVGVWHPKDSVTNEELVDSYNAYVDAFNEDNKAQIDAGEIAAMPYSSAEFIEKASGIKSRYIYQKEGALDIKRM 84 
71278947    1 MAVVISGTGLYTPTQSISNDELVHCFNQYVEKFNLTHSQEIEAGKIVALSPSDSSFIEKASGIKSRYVMEKESILNVDIM 80 
152996180   3 SSVVISGVGLWTPAYSISNEELVDSYNAWAEQFNAKNADAIEKGQIEAKPLSSAAFIEKASGIKSRYIYSKDGALDINRM 82 
109899602   3 NSVVISGSGLWNPPHSISNEELVDAYNAYAQQFNEQNADEIESGAITAKPFSSAEFIQKASGIRSRYCYMKDGVLDINRM 82 
13471587    1 --------------------------------------------------------------MKSRHVIEREGILDPTRM 18 
262193455   3 TGTAITGTGIHVSENVVSNEELCAIFNAYVQRENQRNAAAIAAGEAQPLAESSPAFIVKASGIERRHVVDAEGILDIDRM 82 
110634381  23 GRVCLSGLGVEIPRAVISNEELVDSFNRWVETQNIRRAALGE----EPLPRSDADFIVQASGIRQRHVYEREGILDPARM 98 
296113083  81 APIFPARKlGEELSVMAEMGLAALKDALDRAKLTADDLDGIICASSNFQRCYPAIAIEIQHAIGMQhGFAYDMNVACSAA 160
119774647  83 MPLIPERP-ADALSLQGEMGVLAAQEALANAGLQPSDIDLVIVACAYTQRAYPAMAIEIQQALGTS-GFGFDMQVACSSA 160
91793871   83 MPLIADAP-SDALSMQASMGIEAAKQALVEANLCGEDIDLVIVACAYTQRAYPAISIEIQQALGTQ-GFAYDMLVACSSA 160
196158083  85 KPKISPRG-DDELSHQAEIAVEAAKLALASANLEAADIDAVIVSCAYTQRAYPAIAIEVQEALNIE-GFGFDMLVACSAA 162
71278947   81 SPRYTERD-NDQLSMQAEIGVAAAKEAMLAANKTPADIDLIIVACAYTQRSYPAMAIEIQNALGCG-GWGFDMLVACSAA 158
152996180  83 RPILEIRN-DEQISHQAEMAIAAAKKALEAANKKASDIDMVIVSCAYTQRSYPAIAIEVQSALGIE-GFGFDMLVACSAA 160
109899602  83 RPIIPERG-EEELSDQAEMAINAAKLALEAANKTAEDIDVVIVSCAYTQRSYPALAIEVQGALGIK-GFGFDMLVACSAA 160
13471587   19 TPRIPARP-DDALSLEAEFGIASARKALDHAGVEPSQIDLIICSASHHQRPYPAIAIEMQEALGTT-GAGFDMGLGCSSA 96 
262193455  83 TPNIPDRP-DDELCVQAEYAVRAAEKALAAAGRAAEEIDLVILATSTLQRPYPSISVEIQHALGAR-GYAYDMTMGCSSV 160
110634381  99 APRIPARR-DDELSVMAEFGLKAARKALDHARLSPRDIDLVICSAAHHQRPYPAIAIEIQQALGAE-GAAFDMGLGCSSA 176
296113083 161 TFGIAQAVGSIKAGlGKKIAVLNVEITSAHLNWRNRDSHFIFGDVAAATIVEELSTP----KGYEILDSKLYTQFSANIK 236
119774647 161 TFGLAAAKGLIAQGsARRALVICPEICSAQVNYRDRDSHFIFGDVATAMVVEPLAGSrs-hQSFEILGHRCVTQYSNNIR 239
91793871  161 TFAIVNALNAIRGGtARRVLVINPELTSPQINFKDRDSHFIFGDVATAVVVEDAQLCkt-dNAFSILSSRCVTNYSNNIR 239
196158083 163 TFGMHRAYEMLCAKnASRVLVINPELVSPQINYTDRDSHFIFGDVATATVLELAETAks-eHVYDVLSTKALTKFSNNIR 241
71278947  159 TFGIINAANAIRSGtAKTVLVINPEILSPQINYRDRDSHFIFGDVATASIIEDESTAna-eHVFKIISEKPMTSFSNNIR 237
152996180 161 TFGLQRAVDAIKAGsSKGVLVINPELTSPQVNYMDRDSHFIFGDVATAVVVESSETCqs-aHSFDVLSSKCITSYSNNIR 239
109899602 161 TFALHRAYEMISAGtAKGVLVINPELTSPQVNYCDRDSHFIFGDVATAMVVEHADTAts-eHVFDILSTKAITQYSNNIR 239
13471587   97 AAALHMAVNLVRSGaHKRILVTTPEIITGHLNFRDRQTHFIFGDASVSMVVEGLAQGdkrpGRFEVLDTRLWTQMSNNIR 176
262193455 161 TYGIRAASDAIRCGhAKRALVVNAELCTPFADFRDRDCHFIFGDAGTAVLVEPCDDVar-aGAFEILSSRAFASYSNNIR 239
110634381 177 LLGLHTAANLVRTGaHRRVLVVTPELITAHLDFRDRQTHFIFGDAATAMVVEGMDSGgsysGRFEVIDTRLWTQFSSNIR 256
296113083 237 NEYGFMDRSeflAADtqmyadikePVTDKLFLQEGRKVFREVCPKVSEIITIHLTENNLSADQIKRMWLHQANINMIDLI 316
119774647 240 SNFGFLNRC---DPAt-------aYDADKLFHQQGRKVFKELLPMIYSHLDSQFADAGLTPEAMKRLWLHQANINMNQFV 309
91793871  240 SNFGFVNRC---DPAn-------aQNADKLFHQQGRKVFKELLPMIYQHLDEQFNDEQIKPDEFKRLWLHQANINMNMFV 309
196158083 242 SNFGYMTRA---EDVd-------pYGPDKLFHQAGRKVFKEVCPMAAAHIEAHLASHDLTPEGVKRWWLHQANINMNTLI 311
71278947  238 SNIGYMNNC---SPEn-------sDNDDKFFIQQGRKVFKEVLPMVSNLITSEMAKMDIGADDIKRLYLHQANINMNNFI 307
152996180 240 SNFGYTTRV---TDEd-------pYSADMLFHQNGRKVFKEVCPMAADHIENHLKSQGIQVSQLKRWWLHQANINMNLLI 309
109899602 240 SNFGYVSRA---NDVd-------pYGADKLFHQEGRKVFKEVCPMAAEHISEHLERHQLTSADVKRWWLHQANINMNTLI 309
13471587  177 TNLGYHTRTaqdDPYm-------iNLEGNLIKQVGNKVFKEVTVAGQKFIVEFLAEHGLTPQAIRRFWLHQANARMNAMI 249
262193455 240 NNIGHINRC---DPDn-------qHARDKLFYQQGRRVFKDIVPLASRFILDHLEAHELAPQDIARFWLHQANSNMNDLI 309
110634381 257 TNFGFLSRLaqdDPYn-------lAVEGQLIKQAGSKVFKEVTLAGHQFIVDFLGEYGHTPLTMRRFWLHQANARMNKMI 329
296113083 317 LRTVVGKDADKSIAPVVIAEYGNTSSASPVVAFHETQDGVESEDLCVMCSFGAGYSIGSVLLKKV 381
119774647 310 VKKLLGDDVSADTAPVVLDRYANTASAGSVIALHQHREGLGSGDLGLLCSFGAGYSIGSFILRAV 374
91793871  310 VKKLLGDDVDPIKAPIVLNEYANTASAGSVIAFHKYKQDFVRGDLGLLCSFGAGYSIGSIVLEKN 374
196158083 312 CKRLLGRDADRTEAPIVLDEFANTASAGSVIAFGLNHEDLVSGDVGVLCSFGAGYSIGSLVIRKR 376
71278947  308 GKKVLGREPSSAEAPIILDEYANTSSAGCIIALHKNKQDLATGDKSVLCSFGAGYSACCLLLEYV 372
152996180 310 SKRLLGRDATLEEAPVVLDEYANTASAGSIIAFAKYHEDLTAGDIGVICSFGAGYSIGSLILRKR 374
109899602 310 SKRLLGREATVEEAPIVLDRYANTASAGSIIAFNLHHKDLQAGDYGLLCSFGAGYSIGSLLVRKR 374
13471587  250 LKLSFGHDVDHDRAPMVLERLGNTAGAGAIVALSENHADMKPGDFGLICAFGAGYSIGGALIRML 314
262193455 310 AKRVLGHEPSTESAPLVLAEYGNTASSGSIIAFDQHHEDLAAGSYGFLCSFGAGYSIGSALLRRM 374
110634381 330 LKLAFGEEVGQDRAPTVLERLGNTAAAGAIIALAENYEDMQPGEFGLLCAFGAGYSIGGALLRMM 394
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap