Conserved Protein Domain Family
PRK06467

?
PRK06467: PRK06467 
dihydrolipoamide dehydrogenase; Reviewed
Statistics
?
PSSM-Id: 180579
View PSSM: PRK06467
Aligned: 182 rows
Threshold Bit Score: 752.171
Threshold Setting Gi: 296112302
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
254786520   1 MSNKYDVIVIGSGPAGYVAAIRAAQLGLKTACIEKWKdkqgngVNGGTCLNVGCIPSKALLDSSHKYHEAKsAYAAHGIG 80 
299768991   1 MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIhng-kpSLGGTCLNVGCIPSKALLDSSHRYEDTVhHLADHGIT 79 
184159273   1 MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIhng-kpSLGGTCLNVGCIPSKALLDSSHRYEDTVhHLADHGIT 79 
213157647   1 MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIhng-kpSLGGTCLNVGCIPSKALLDSSHRYEDTVhHLADHGIT 79 
169632626   1 MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIhng-kpSLGGTCLNVGCIPSKALLDSSHRYEDTVhHLADHGIT 79 
169794948   1 MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIhng-kpSLGGTCLNVGCIPSKALLDSSHRYEDTVhHLADHGIT 79 
215482496   1 MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIhng-kpSLGGTCLNVGCIPSKALLDSSHRYEDTVhHLADHGIT 79 
296112302   1 MKNSYDLVVIGGGPGGYEAAIRGAQLGFSVACIEKRVhkg-epALGGTCLNVGCIPSKALLDSSHRFEATKhELTDHGIT 79 
148652080   1 MKDNYDLVVIGGGPGGYEAAIRAGQLGMSVACIEKRVykg-epALGGTCLNVGCIPSKALLDSSHRYEATKhELAEHGIT 79 
93004944    1 MKDSYDLVVIGGGPGGYEAAIRAGQLGMSVACIEKRVykg-epALGGTCLNVGCIPSKALLDSSHRYEATKhDLNEHGIT 79 
254786520  81 VNDVSIDVPSMIARKEKIVKQMSTGITGLFKANKVTPLFGTGKLLAN----RKVQFVSKDGN-EEILEAENVILASGSLP 155
299768991  80 TGEVNFDLAKLLARKDKIVDQLTGGIDQLLKGNGIEWLKGTGKLLAG----KKVEFVSHEGE-TQVLEPKYVILASGSVP 154
184159273  80 TGEVNFDLAKLLARKDKIVDQLTGGIDQLLKGNGIEWLKGTGKLLAG----KKVEFVPHEGE-TQILEPKYVILASGSVP 154
213157647  80 TGEVNFDLAKLLARKDKIVDQLTGGIDQLLKGNGIEWLKGTGKLLAG----KKVEFVPHEGE-TQILEPKYVILASGSVP 154
169632626  80 TGEVNFDLAKLLARKDKIVDQLTGGIDQLLKGNGIEWLKGTGKLLAG----KKVEFVPHEGE-TQILEPKYVILASGSVP 154
169794948  80 TGEVNFDLAKLLARKDKIVDQLTGGIDQLLKGNGIEWLKGTGKLLAG----KKVEFVPHEGE-TQILEPKYVILASGSVP 154
215482496  80 TGEVNFDLAKLLARKDKIVDQLTGGIDQLLKGNGIEWLKGTGKLLAG----KKVEFVPHEGE-TQILEPKYVILASGSVP 154
296112302  80 TGDVNIDIAKMLERKDSIVKGLTQGVAGLLKGNGVDWLQGWGTLVDGkgaeKQVKFTPLEGD-ESTITAKYVILAAGSVP 158
148652080  80 TSDVEIDVAKMIERKEGIVKQLTGGVAMLLKGNGVDWLQGWGTLVDGkgsdKKVKFTALADEsETVITAKNVILAAGSVP 159
93004944   80 TGDVAIDIEQMIARKEGIVKQLTGGVAALLKGNGVDWLQGWGTLEDGkgtdKKVKFTALADEaETTITAKNVILAAGSVP 159
254786520 156 VNIPVAPVDGDV--IVDSTGALEFTEVPERLGVIGAGVIGLELGSVWKRLGSNVILLEAMESFLAMMDQQVAKEAQKIYK 233
299768991 155 VNIPVAPVDQDI--IVDSTGALNFPEVPKRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDAFLPMADKALAKDYQKLLT 232
184159273 155 VNIPVAPVDQDI--IVDSTGALNFPEVPKRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDAFLPMADKALSKEYQKILT 232
213157647 155 VNIPVAPVDQDI--IVDSTGALNFPEVPKRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDAFLPMADKALSKEYQKILT 232
169632626 155 VNIPVAPVDQDI--IVDSTGALNFPEVPKRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDAFLPMADKALSKEYQKILT 232
169794948 155 VNIPVAPVDQDI--IVDSTGALNFPEVPKRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDAFLPMADKALSKEYQKILT 232
215482496 155 VNIPVAPVDQDI--IVDSTGALNFPEVPKRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDAFLPMADKALSKEYQKILT 232
296112302 159 IEIPVAKTDGEY--IVDSTGALEFAEVPKRLGVIGAGVIGLELGSVWRRLGAEVVVYEAMPEFLAVADKDISKEAAKLLK 236
148652080 160 IDIPVAPVNNEEgiIVDSTGALDFTETPKRLGVIGAGVIGLELGSVWRRLGAEVVVYEALPEFLAAADKDIAKEAGKLLK 239
93004944  160 IDIPVARTDGDR--IVDSTGALDFTAVPKRLGVIGAGVIGLELGSVWRRLGAEVVVYEALPSFLAAADKDIAKEAGKMLK 237
254786520 234 KQgLDIRLGCRVTGSEVVEkdgkKEVIVTYSDKDGnEATETFDKLIVCVGRRPFTDGLLSDDSGVKLDERGSIYVNDLCS 313
299768991 233 KQgLDIRIGAKVAGTEVNG----REVTVKYTQGGE-EKTQTFDKLIVCVGRKAYAEGLLADDSGIKLTERGLVEVNDYCA 307
184159273 233 KQgLDIRIGAKVSGTEVNG----REVTVKYTQGGE-DKEQTFDKLIVCVGRKAYAEGLLAEDSGIKLTERGLVEVNDHCA 307
213157647 233 KQgLDIRIGAKVSGTEVNG----REVTVKYTQAGE-DKEQTFDKLIVCVGRKAYAEGLLAEDSGIKLTERGLVEVNDHCA 307
169632626 233 KQgLDIRIGAKVSGTEVNG----REVTVKYTQGGE-DKEQTFDKLIVCVGRKAYAEGLLAEDSGIKLTERGLVEVNDHCA 307
169794948 233 KQgLDIRIGAKVSGTEVNG----REVTVKYTQAGE-DKEQTFDKLIVCVGRKAYAEGLLAEDSGIKLTERGLVEVNDHCA 307
215482496 233 KQgLDIRIGAKVSGTEVNG----REVTVKYTQAGE-DKEQTFDKLIVCVGRKAYAEGLLAEDSGIKLTERGLVEVNDHCA 307
296112302 237 KQgLDIRVDTKVTGAEVKD----GQVIVTTDVKGE-TQTDTFDKLIVCVGRRAYSEKLLAENCGIELTERGLVAVDDQCK 311
148652080 240 KQgLDIRVDTKVTGTEIKD----GQVVVTSEKGGE-SAEETFDKLIVCVGRRAYSEKLLGEDSGITLTDRGLVEVDDQCK 314
93004944  238 KQgLDIRVDTKVTNAEVQG----DQVIVTSETKGE-SSEESFDKLIVCVGRRAYSEKLLGEDSGIQLTERGLIDVNDQCK 312
254786520 314 TSAPGVWAIGDVVRGPMLAHKGSEEGVMVAERIAGQKTVMNYDIIPNVIYTHPEIASVGRTEEQIKADGEEYNVGVFPFL 393
299768991 308 TSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIISVIYTHPEAAWVGLTEEQAKEKGHEVKTGQFGFA 387
184159273 308 TSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIISVIYTHPEAAWVGLTEEQAKEKGHEVKTGQFGFA 387
213157647 308 TSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIISVIYTHPEAAWVGLTEEQAKEKGHEVKTGQFGFA 387
169632626 308 TSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQINYDTIISVIYTHPEAAWVGLTEEQAKEKGHEVKTGQFGFA 387
169794948 308 TSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIISVIYTHPEAAWVGLTEEQAKEKGHEVKTGQFGFA 387
215482496 308 TSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIISVIYTHPEAAWVGLTEEQAKEKGHEVKTGQFGFA 387
296112302 312 TNLDGVYAIGDLVRGPMLAHKAMEEGMMAVERIHGEKAQVNYDTIISVIYTHPEIAWVGLSEQAATEQGYEVKTGSFSLS 391
148652080 315 TNLDGVYAIGDLVRGPMLAHKAMEEGMMAVERIHGEKAQVNYDTIINVIYTHPEIAWVGLTEQQAVEQGYEVKTGSFNLA 394
93004944  313 TNLDGVYAIGDLVRGPMLAHKAMEEGMMAVERIHGEKAQVNYDTIINVIYTHPEIAWVGLTEQEAEVAGYEVKTGSFNLA 392
254786520 394 AIGRAVAADESDGIVKMIADAKTDRVLGCHIVGPSAPDLVQQVAIAMEFGSSAEDIGMTIFGHPTFSEAVKEAALAVNGH 473
299768991 388 VNGRALAAGEGAGFVKFVADAKTDRLLGMHVIGPAASDIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGR 467
184159273 388 VNGRALAAGEGAGFVKFVADAKTDRLLGMHVIGPAASDIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGR 467
213157647 388 VNGRALAAGEGAGFVKFVADAKTDRLLGMHVIGPAASDIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGR 467
169632626 388 VNGRALAAGEGAGFVKFVADEKTDRLLGMHVIGPAASDIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGR 467
169794948 388 VNGRALAAGEGAGFVKFVADAKTDRLLGMHVIGPAASDIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGR 467
215482496 388 VNGRALAAGEGAGFVKFVADAKTDRLLGMHVIGPAASDIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGR 467
296112302 392 ANGRALAQGEGVGLIKVVADAKTDRLLGMHAVSVGAGDIVHQGMIAMEFVSSIEDLQLMTFAHPTVSEAVHEAALSADGR 471
148652080 395 ANGRALAQSEAQGSIKVVADAKTDRLLGMHAICAGAGDIVHQGMIAMEFVSSIEDLQLMTFAHPTISEAVHEAALSADGR 474
93004944  393 ANGRALAQSEAQGSIKVVADAKTDRLLGMHAISAGAGDIVHQGMIAMEFVSSIEDLQLMTFAHPTISEAVHEAALSADGR 472
254786520 474 AIHMPNRKKK 483
299768991 468 AIHAIQRKRK 477
184159273 468 AIHAIQRKRK 477
213157647 468 AIHAIQRKRK 477
169632626 468 AIHAIQRKRK 477
169794948 468 AIHAIQRKRK 477
215482496 468 AIHAIQRKRK 477
296112302 472 AIHAIQRKKR 481
148652080 475 AIHAIQRKKR 484
93004944  473 AIHAIQRKKR 482
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap