Conserved Protein Domain Family
PRK05963

?
PRK05963: PRK05963 
3-oxoacyl-(acyl carrier protein) synthase II; Reviewed
Statistics
?
PSSM-Id: 180328
View PSSM: PRK05963
Aligned: 19 rows
Threshold Bit Score: 454.949
Threshold Setting Gi: 154246856
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
300024702   1 MSGVEIIGLGHYAPERIVPNSEIEARLGLDAGWIKRRTGIDERRYAANDQALSDLAIRAGDMAITRAGLAREDIGLLLLA 80 
161620554   3 VCSSRLAGFGHAVPDRRVENAEIEAQLGLETGWIERRTGIRCRRWAMPDETLSHLAASAADMALSDAGIERSDIALTLLA 82 
83269629    3 VCSSRLAGFGHAVPDRRVENAEIEAQLGLETGWIERRTGIRCRRWAMPDETLSHLAASAADMALSDAGIERSDIALTLLA 82 
189022896   3 VCSSRLAGFGHAVPDRRVENAEIEAQLGLETGWIERRTGIRCRRWAMPDETLSHLAASAADMALSDAGIERSDIALTLLA 82 
154246856   6 VAGTRIAGFGHYAPEQVVTSVEIERGLGLTEGWIVGRTGIRERRVAAPHEAVSDLAFAAAEKALADAGIPKAAIGLTLLA 85 
159185988   3 TRSSRMAGFGHAVPARCVDNAEIEASLGLEAGWIERRTGIRSRYWAEAGDTLSGLAERAGRMALEDAKINADDIALTLLA 82 
227823048   4 IRSSRLAGFGHSVPARRVDNAEIETQLGLEPGWIERRTGIRARRWVEAGDTLSRLAAKAGEAALNEAGISRGDIALTLLA 83 
153010143   2 SISSRMAGFGHYVPDRRVANAELEQRFGLEAGWIERRTGIRERRWAAPDETLTDMAMKAGAMALDNAGVPHSSVALVILA 81 
209883893  13 MRASRIVGLGHHVPARRVANAELEQELGLSQGWIERRTGIKARRWAAADEAVTDLAIEAASRALAQAKAQIGEIGLVLLA 92 
13474852    2 SKSSRILGFGHHTPGRKVANAEIENNLGLEPGWIERRTGIRSRFWATDGDTLSGLATQAGDIALANAGIDRSDIGLLLLA 81 
300024702  81 TSTPDHLLPPTAPLVAHRLGLGNAGGIDMAGACAGFMYALTLADSFVRSQCVTVLVIAANILSRRINEAERASSVLFADG 160
161620554  83 TSTPDHLLPPTAPLLTHWLNLQNSGAADLAGACTGFLYALVLADGFVRAQGKPVLVVAANLLSRRINMAERASAVLFGDA 162
83269629   83 TSTPDHLLPPTAPLLTHWLNLQNSGAADLAGACTGFLYALVLADGFVRAQGKPVLVVAANLLSRRINMAERASAVLFGDA 162
189022896  83 TSTPDHLLPPTAPLLTHWLNLQNSGAADLAGACTGFLYALVLADGFVRAQGKPVLVVAANLLSRRINMAERASAVLFGDA 162
154246856  86 TSTPDHLLPPTAPLLAHRLGLPASGAVDLTGACAGFLYALVLADGFVRTTGRAVLVAAANILSRRVDPSDPSTAALFADA 165
159185988  83 TSTPDHLLPPSAPLLAHRLGLTRSGAIDLAGACSGFLYALTLADGFVRTYGRAVLVVAANILSRRINPAERASAVLFADA 162
227823048  84 TSTPDHLLPPSAPLLAHRLGLANSGAIDLAGACSGFLYALTLADGFVRAQGKPVLVVAANILSRRINPAERASAVLFADA 163
153010143  82 TSTPDHLLPPSAPLLAHKLGLENCGGIDLAGACSGFLYALVLADGFVKNFRKPVLVVAANILSRRISMEERNTAILFADA 161
209883893  93 TSTPDHLLPPSAPLLAHRLGL-SCGAIDLTGACSGFVYAMTFADGVVKSTGQAVLVVAANILSRRINNSDIASAVLFADA 171
13474852   82 TSTPDHLLPPSAPLVAHKLGLGRAGAVDLTGACAGFVYALMFADGFTRLHGKPALVIAANILSRRINPAERASSVLFADA 161
300024702 161 AGAVLLAPSARQNSgvVGAHLAAQGAHYDLISIPAGGSRRPFARDLDASETLMILSDGQAVYSKAVAMMSNAAEIALRKA 240
161620554 163 AGAVVLAPSAKANS--FQSQFITNGSHYDLIKVPAGGSARAYAPERDASEFLMTMQDGRAVFTEAVRIMSGASQNVLASA 240
83269629  163 AGAVVLAPSAKANS--FQSQFITNGSHYDLIKVPAGGSARAYAPERDASEFLMTMQDGRAVFTEAVRIMSGASQNVLASA 240
189022896 163 AGAVVLAPSAKANS--FQSQFITNGSHYDLIKVPAGGSARAYAPERDASEFLMTMQDGRAVFTEAVRIMSGASQNVLASA 240
154246856 166 AGAVVLAPSPREGAgvVGSCLASDGSGYDLIQIPDSGSRLSATGQAGAGR--MVMREGRTVFSRAVAMMASSCRTALEEA 243
159185988 163 AGAVVLTPCPEVKRgvLSADLVADGSGYDLIQIAAGGSSQPFSAGMIAEDALMTMRDGREVFSRAVALMTNTSQRVLHEA 242
227823048 164 AGAVVVAPSNDSDRglVGVDLASDGSGYDLITIPAGGSSRPFAPGMAAEDVLMTMRDGREVFVRAVEMMSTCATRALAAA 243
153010143 162 AGAVLLAPSNDPHEglRGSALISDGGNYGLISIPAG-------------DTRMTMQDGKAVFTQAVRMMTRCAADVLEQA 228
209883893 172 AAAVVLAPSARDDVgvLGTSLLSDGSFYDMIAIKAGGTRNPDLSGALAEDRVIRIKDGKVVFEKAIKLMTQSAEEALARA 251
13474852  162 AGALVIGPCEDPYQgiLGASVDSDGSRYGLIQIPAGGSNTPFHGELDLEQTRMTITDGREVFAKAVEMMTACSQDALAAA 241
300024702 241 GVTAADVTHFIPHQANARMMGTVAHQIGVDPDRARSTVAMFGNSSAATIPLTLSMSAQEHRYAPGDIVLMTAAGAGLTGG 320
161620554 241 AMLPQAIDRFFPHQANIRIVDKVCETIGVPRAKAASTLETYGNSSAATIPLSLSLANLEQPLREGERLLFAAAGAGMTGG 320
83269629  241 AMLPQAIDRFFPHQANIRIVDKVCETIGVPRAKAASTLETYGNSSAATIPLSLSLANLEQPLREGERLLFAAAGAGMTGG 320
189022896 241 AMLPQAIDRFFPHQANIRIVDKVCETIGVPRAKAASTLETYGNSSAATIPLSLSLANLEQPLREGERLLFAAAGAGMTGG 320
154246856 244 GLTLDDVTHFLPHQANARIITAVAERLGISPERTLSSVADYGNSSAATVPFTLSALRATRAYGAGDVLLIAAAGAGLTGG 323
159185988 243 ELTAADISRFVPHQANARMSDAVCGNLGIEREKTVRTIGSFGNSSAATIPLSLSITNAERPLAGGETLLLTAAGAGMTGG 322
227823048 244 GLGPTEVSRFVPHQANVRIFDAVCGNLDIDPSKTVRTIEEYGNSSAATIPLSLSLAHRAKPFAAGEKLLLTAAGAGLSGG 323
153010143 229 KLAAADVDRFFPHQANMRMIDKVCDQLHLPASIAARTIHTFGNSSAATIPLSLSLASKSRPFQPGERLLLSAAGAGMLAG 308
209883893 252 NVTAAQIDRFIPHQANARIFDRVAENLAIAPARTLRSIEEFGNSSAATIPLTLSVAAERAPLADGELLLMAAVGAGFTSG 331
13474852  242 RMRPQDIDRFVPHQANARIFDAVGRNLGIADEAIVKTIAEYGNSSAATIPLSLSLAHRAAPFRPGEKVLLAAAGAGLSGG 321
300024702 321 AAVFRW 326
161620554 321 AVLMQV 326
83269629  321 AVLMQV 326
189022896 321 AVLMQV 326
154246856 324 AAVFRF 329
159185988 323 AVVYRV 328
227823048 324 AVVVGL 329
153010143 309 AAVWKI 314
209883893 332 AIVFRV 337
13474852  322 ALVVGI 327
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap