Conserved Protein Domain Family
PRK05949

?
PRK05949: PRK05949 
RNA polymerase sigma factor; Validated
Statistics
?
PSSM-Id: 180321
View PSSM: PRK05949
Aligned: 14 rows
Threshold Bit Score: 556.379
Threshold Setting Gi: 113474616
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166364164   1 MPTAKTNQTQSQPT---------LNADMVRTYLHEIGRVPLLTHEQEIIYGKQVQRMMSLLETKEALSKQLGREPDRLEW 71
gi 16331222   18 MPTANLSSPTSPPT---------FTADMVRSYLHEIGRVPLLTHEQEIILGKQVQQMMALLEHKKALADRLGREPSDPEW 88
gi 298490639   1 MPTVNTQTENLNTK---------FTADMVRTYLREIGRVPLLTREQEIVYGKQVQQMMTLLDAKEVLAKKLDHEPSLPEW 71
gi 75908126    1 MPTVNTHTEDTNTK---------FTADMVRTYLREIGRVPLLTREQEIVYGKQVQQMMSLIDAKEALAKKLDREPSLPEW 71
gi 17231292    1 MPTVNTHTEDTNTK---------FTADMVRTYLREIGRVPLLTREQEIVYGKQVQQMMSLIDAKEALAKKLDREPSLPEW 71
gi 186684216   1 MPTVNTQTENLNTR---------FTADMVRTYLREIGRVPLLTREQEIVYGKQVQQMMTLIDAKEVLAKKLHREPDMSEW 71
gi 113474616   1 MSKLNQENKNQKKTqtkfgpttySSMDTVRTYLHEIGRVPLLTREEEIVYGKQVQQMMQFLELKEKLEEKLNRTATLLEW 80
gi 172035560   1 MPTANVNTKTKQPT---------YSADMVRTYLHEIGRVPLLTHEQEIIYGKQVQKMMSLLETKEELAQSLGKEPSLQEW 71
gi 218439771   1 MPTAKVNPKTQKPT---------FSADMVRTYLHEIGRVPLLTHEQEIVYGKQVQKMMTLLEKKDQLAIELGKEPNLTEW 71
gi 220907004   1 MSTLKTKTQTRDSM---------VSTDMVRTYLHEIGRVPLLTHEQEIVLGKQVQQLMELLEAREKLTTSLDRSPTAEEW 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166364164  72 ADSVNLSENELDRALKTGDRAKRKMIEANLRLVVAIAKKYQKRNMEFLDLIQEGSLGLERGVEKFDPTKGYKFSTYAYWW 151
gi 16331222   89 AEAADLSVTKLHRYLGQGERAKRKMIEANLRLVVAIAKKYQKRNMEFLDLIQEGSLGLERGVEKFDPTKGYKFSTYAYWW 168
gi 298490639  72 AAHVNQSETEVKQTVAQGKRAKQKMIEANLRLVVAIAKKYQKRNMEFLDLIQEGTLGLERGVEKFDPMRGYKFSTYAYWW 151
gi 75908126   72 ADHVQKSETEVKQTVTQGKRAKQKMIEANLRLVVAIAKKYQKRNMEFLDLIQEGTLGLERGVEKFDPMRGYKFSTYAYWW 151
gi 17231292   72 ADHVQKSETEVKQTVTQGKRAKQKMIEANLRLVVAIAKKYQKRNMEFLDLIQEGTLGLERGVEKFDPMRGYKFSTYAYWW 151
gi 186684216  72 ADVVQQSETEVQQTVAQGKRAKQKMIEANLRLVVAIAKKYQKRNMEFLDLIQEGTLGLERGVEKFDPMRGYKFSTYAYWW 151
gi 113474616  81 AEHLLVSEKVLKQAIKQGQRAKQKMIEANLRLVVAIAKKYQKRNMEFLDLIQEGTLGLERGVEKFDPTRGYKFSTYAYWW 160
gi 172035560  72 AKEVNLEEKALTKALEQGERAKRKMIEANLRLVVAIAKKYQKRNMEFLDLIQEGSLGLERGVEKFDPTKGYKFSTYAYWW 151
gi 218439771  72 ANQVQMSEEELNRAIQQGKRAKRKMIEANLRLVVAIAKKYQKRNMEFLDLIQEGSLGLERGVEKFDPTKGYKFSTYAYWW 151
gi 220907004  72 AEQANLSVADLNTAVRRGQRAKQKMIEANLRLVVSVAKKYQKRNLELLDLIQEGTLGLERGVEKFDPTRGYKFSTYAYWW 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166364164 152 IRQAITRAIAQQARTIRLPIHITEKLNKIKRTQRELAQKLGRSATPAEIALELELEPAQIREYLSMARQPISLDVRVGDN 231
gi 16331222  169 IRQAITRAIAQQGRTIRLPIHITEKLNKIKKTQRELSQQLGRSATPAEVAKALEIDPSQIREYLSLSRQPISLDVRVGDN 248
gi 298490639 152 IRQAITRAIAQQGRTIRLPIHITEKLNKIKKVQRELAQKLGRSPSPTEIAKELELEPAQIREYLNMARQPVSLDVRVGDN 231
gi 75908126  152 IRQAITRAIAQQGRTIRLPIHITEKLNKIKKVQRELAQTLGRSPSPAEIAKELELEPAQIREYLNMARQPVSLDVKVGDN 231
gi 17231292  152 IRQAITRAIAQQGRTIRLPIHITEKLNKIKKVQRELAQTLGRSPSPAEIAKELELEPAQIREYLNMARQPVSLDVKVGDN 231
gi 186684216 152 IRQAITRAIAQQGRTIRLPIHITEKLNKIKKVQRELAQTLGRSPTPAEIAKELELEPAQIREYLNMARQPVSLDVKVGDN 231
gi 113474616 161 IRQAITRAIAQQARTIRLPIHITEKLNKIKRVQRELIQSLGRSPTPSEIAQALELEPSQIREYLLMARHPISLDLRVGDN 240
gi 172035560 152 IRQAITRAIAQQARTIRLPIHITEKLNKIKKTQRELSQTLGRSATPAEIAQELEIEPSQIREFLSIARQPISLDVRVGDN 231
gi 218439771 152 IRQAITRAIAQQARTIRLPIHITEKLNKIKKTQRELSQQLGRSATPAEIAKALDLEPAQIREFLSMSRQPISLDVRVGDN 231
gi 220907004 152 IRQAITRAIAQQARTVRLPIHITEKLNKIKKAQRVLSQRLGRSATPAEIAQELELEPSQIREYLTLARQPVSLDLRVGDN 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166364164 232 QDTELSELLEDSGVSPDTFITQELLRQDLANLLAELTPQQREVITLRFGLTDGKELSLAKIGQRMNISRERVRQLEHQAL 311
gi 16331222  249 QDTELSELLEDEGVSPDAYITQESMRQDLQNLLAELTPQQQAVLTMRFGLNDGQELSLAKIGQHLNISRERVRQLENQAL 328
gi 298490639 232 QDTELQEMLEDEGPSPEYYTTQEFLRQDLNNLLAELTPQQREVLALRFGLEDGNEMSLAKVGERLNLSRERVRQLEHQAL 311
gi 75908126  232 QDTELQEMLEDEGPSPEYYTTQEFLRQDLNTLLAELTPQQREVVALRFGLLDGNELSLAKVGERLNLSRERVRQLEHQAL 311
gi 17231292  232 QDTELQEMLEDDGPSPEYYTTQEFLRQDLNTLLAELTPQQREVVALRFGLLDGNELSLAKVGERLNLSRERVRQLEHQAL 311
gi 186684216 232 QDTELQEMLEDSGPSPEYYTNQEFLRQDLNNLLAELTPQQREVLALRFGLEDGNEMSLAKVGERLNLSRERVRQLEHQAL 311
gi 113474616 241 QDTELQELLEDETSSPDDYITGELLRQDINTLLAELSEQQRRVLVLRFGLEDGKEMSLAKVGDKLQLSRERVRQLEHQAL 320
gi 172035560 232 QDTELSELLEDQGVSPDIYITQELLRQDLSNLMAELTPQQRTVLTLRFGLEDGKELSLAKIGKRLNISRERVRQLEHQAL 311
gi 218439771 232 QDTELSELLEDEGISPDNYITQELMRQDLHDLLAELTPQQREVLSLRFGLQDGKELSLAKIGQRMNISRERVRQLEHQAL 311
gi 220907004 232 QDTELRDLLEDDSPSPEQYTTGEALRDDVNHLLAELTPQQREVLTLRFGLEDGKELSLAKVGEQLSLSRERVRQLERQAL 311
                        330
                 ....*....|....*.
gi 166364164 312 AHLRRRRANVKEYIVA 327
gi 16331222  329 AQLKRRRANMAEYIIA 344
gi 298490639 312 AHLRRRRANVKEYVAS 327
gi 75908126  312 AHLRRRRANVKEYVAS 327
gi 17231292  312 AHLRRRRANVKEYVAS 327
gi 186684216 312 AHLRRRRANVQEYVAS 327
gi 113474616 321 AFLRRRQAKVREYVAS 336
gi 172035560 312 AQLRRRRGNVKEYLAA 327
gi 218439771 312 SQLRRRRSNVKEYIVA 327
gi 220907004 312 DHLRRRKLQVREYLAS 327
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap