Conserved Protein Domain Family
PRK05826

?
PRK05826: PRK05826 (this model, PSSM-Id:180277 is obsolete and has been replaced by 235619)
pyruvate kinase; Provisional
Statistics
?
PSSM-Id: 180277
View PSSM: PRK05826
Aligned: 330 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12045070    4 HLKRTKIIATCGPALTkslvslkmlddneyaaikkvAYANIEAIIKSGVSVIRLNFSHGTHEEQQVRIKIVRDVAKAMNI 83 
166154543   1 MIARTKIICTIGPATN--------------------TPEMLEKLLDAGMNVARLNFSHGTHESHGRTIAILKELREKRQV 60 
166155418   1 MIARTKIICTIGPATN--------------------TPEMLEKLLDAGMNVARLNFSHGTHESHGRTIAILKELREKRQV 60 
237802756   1 MIARTKIICTIGPATN--------------------TPEMLEKLLDAGMNVARLNFSHGTHESHGRTIAILKELREKRQV 60 
15618021    1 MITRTKIICTIGPATN--------------------SPEMLAKLLDAGMNVARLNFSHGSHETHGQAIGFLKELREQKRV 60 
15835632    1 MITRTKIICTIGPATN--------------------SPEMLAKLLDAGMNVARLNFSHGSHETHGQAIGFLKELREQKRV 60 
16752947    1 MITRTKIICTIGPATN--------------------SPEMLAKLLDAGMNVARLNFSHGSHETHGQAIGFLKELREQKRV 60 
29840433    1 MIARTKIICTIGPATN--------------------TPEMLEKLLDAGMNVARLNFSHGTHESHGETIRLLKELREKKGA 60 
33241432    1 MITRTKIICTIGPATN--------------------SPEMLAKLLDAGMNVARLNFSHGSHETHGQAIGFLKELREQKRV 60 
62185258    1 MIARTKIICTIGPATN--------------------TPEMLEKLLDAGMNVARLNFSHGTHESHGQTISLLKELREKKGA 60 
12045070   84 PVSIMLDTNGPEIRIVETKKeGLKITKDSEVIINTMSKMIASDNQFAVSdasgkYN--MVNDVNIGQKILVDDGKLTLVV 161
166154543  61 PLAIMLDTKGPEIRLGQVES-PIKVQPGDRLTLVSK-EILGSKESGVTL-----YPscVFPYVRERAPVLIDDGYIQAVV 133
166155418  61 PLAIMLDTKGPEIRLGQVES-PIKVQPGDRLTLVSK-EILGSKESGVTL-----YPscVFPYVRERAPVLIDDGYIQAVV 133
237802756  61 PLAIMLDTKGPEIRLGQVES-PIKVQPGDRLTLVSK-EILGSKESGVTL-----YPscVFPYVRERTPVLIDDGYIQAVV 133
15618021   61 PLAIMLDTKGPEIRLGNIPQ-PISVSQGQKLRLVSSDIDGSAEGGVSLY-----PKg-IFPFVPEGADVLIDDGYIHAVV 133
15835632   61 PLAIMLDTKGPEIRLGNIPQ-PISVSQGQKLRLVSSDIDGSAEGGVSLY-----PKg-IFPFVPEGADVLIDDGYIHAVV 133
16752947   61 PLAIMLDTKGPEIRLGNIPQ-PISVSQGQKLRLVSSDIDGSAEGGVSLY-----PKg-IFPFVPEGADVLIDDGYIHAVV 133
29840433   61 PLAIMLDTKGPEIRLGNIPT-PIQVSRGQKITLVGKEVEGSAEGGVTLH-----PQc-VFPYVREGVDVLIDDGYIQAVV 133
33241432   61 PLAIMLDTKGPEIRLGNIPQ-PISVSQGQKLRLVSSDIDGSAEGGVSLY-----PKg-IFPFVPEGADVLIDDGYIHAVV 133
62185258   61 PLAIMLDTKGPEIRLGKIPT-PIQVSRGQKITLLEKEIEGSLEGGVTLH-----PQc-VFPFVREGTDVLIDDGYLQAVV 133
12045070  162 TRVDKQHnqVICVAKNDHTVFTKKRLNLPNAQYSIPFLSEKDLKDIDFGLSQGIDYIAASFVNTVADIKQLRDYLKLKNA 241
166154543 134 VNAQEHM--VEIEFQNSGEIKSNKSLSIKDIDVALPFMTEKDIADLKFGVEQELDLIAASFVRCNEDIDSMRKVLESFGR 211
166155418 134 VNAQEHM--VEIEFQNSGEIKSNKSLSIKDIDVALPFMTEKDIADLKFGVEQELDLIAASFVRCNEDIDSMRKVLESFGR 211
237802756 134 VNAQEHM--VEIEFQNSGEIKSNKSLSIKDIDVALPFMTEKDIADLKFGVEQELDLIAASFVRCNEDIDSMHKVLESFGR 211
15618021  134 VSSEADS--LELEFMNSGLLKSHKSLSIRGVDVALPFMTEKDIADLKFGVEQNMDVVAASFVRYGEDIETMRKCLADLGN 211
15835632  134 VSSEADS--LELEFMNSGLLKSHKSLSIRGVDVALPFMTEKDIADLKFGVEQNMDVNAASFVRYGEDIETMRKCLADLGN 211
16752947  134 VSSEADS--LELEFMNSGLLKSHKSLSIRGVDVALPFMTEKDIADLKFGVEQNMDVVAASFVRYGEDIETMRKCLADLGN 211
29840433  134 TSVGEDH--LELEFINSGELKSHKSLSIREIDLALPFMTDKDINDLQFGVAQGVDVIAASFVRYAEDIESMRKCLADAGR 211
33241432  134 VSSEADS--LELEFMNSGLLKSHKSLSIRGVDVALPFMTEKDIADLKFGVEQNMDVVAASFVRYGEDIETMRKCLADLGN 211
62185258  134 TSAGNDW--LELEFINSGELKSHKSLSIREIDLALPFMTDKDIHDLKFGVDQGVDVIAASFVRCAEDIESMRKCLADCGR 211
12045070  242 SGVKIIAKIESNHALNNIDKIIKASDGIMVARGDLGLEIPYYQVPYWQRYMIKACRFFNKRSITATQMLDSLEKNIQPTR 321
166154543 212 PNMPIIAKIENHLGVQNFQEIARAADGIMIARGDLGIELSIVEVPGLQKFMARASRETGRFCITATQMLESMIRNPLPTR 291
166155418 212 PNMPIIAKIENHLGVQNFQEIARAADGIMIARGDLGIELSIVEVPGLQKFMARASRETGRFCITATQMLESMIRNPLPTR 291
237802756 212 PNMPIIAKIENHLGVQNFQEIARAADGIMIARGDLGIELSIVEVPGLQKFMARASRETGRFCITATQMLESMIRNPLPTR 291
15618021  212 PKMPIIAKIENRLGVENFSKIAKLADGIMIARGDLGIELSVVEVPNLQKMMAKVSRETGHFCVTATQMLESMIRNVLPTR 291
15835632  212 PKMPIIAKIENRLGVENFSKIAKLADGIMIARGDLGIELSVVEVPNLQKMMAKVSRETGHFCVTATQMLESMIRNVLPTR 291
16752947  212 PKMPIIAKIENRLGVENFSKIAKLADGIMIARGDLGIELSVVEVPNLQKMMAKVSRETGHFCVTATQMLESMIRNVLPTR 291
29840433  212 PDMPIIAKIENRLGVENFSQIAKASDGIMIARGDLGIELSVVEVPNLQKFMAKMSREMGRFCITATQMLESMIRNVLPTR 291
33241432  212 PKMPIIAKIENRLGVENFSKIAKLADGIMIARGDLGIELSVVEVPNLQKMMAKVSRETGHFCVTATQMLESMIRNVLPTR 291
62185258  212 GDMPIIAKIENRLGVENFPQIAKVADGIMIARGDLGIELSVVELPSLQKFMAKISRETGRFCITATQMLESMIRNVLPTR 291
12045070  322 AEVTDVYFAVDRGNDATMLSGETASGLYPLNAVAVMQKIDKQSETFFDYqYNVNYYlKNSTankSRFWHNVVLPLTKKtv 401
166154543 292 AEVSDVANAIYDGTSAVMLSGETASGAHPVHAVKTMRSIIQETEKTFD---------YHAFfqlNDKNSALKVSPYLE-- 360
166155418 292 AEVSDVANAIYDGTSAVMLSGETASGAHPVHAVKTMRSIIQETEKTFD---------YHAFfqlNDKNSALKVSPYLE-- 360
237802756 292 AEVSDVANAIYDGTSAVMLSGETALGAHPVHAVKTMRSIIQETEKTFD---------YHAFfqlNDKNSALKVSPYLE-- 360
15618021  292 AEVSDIANAIYDGSSAVMLSGETASGAHPVAAVKIMRSVILETEKNLSH-DSFLKL--------DDSNSALQVSPYLS-- 360
15835632  292 AEVSDIANAIYDGSSAVMLSGETASGAHPVAAVKIMRSVILETEKNLS---------HDSFlklDDSNSALQVSPYLS-- 360
16752947  292 AEVSDIANAIYDGSSAVMLSGETASGAHPVAAVKIMRSVILETEKNLS---------HDSFlklDDSNSALQVSPYLS-- 360
29840433  292 AEVSDVANAIYDGTSAVMLSGETASGSYPVAAVKIMRSVIQETEKNLN---------YKSFlelSDSECAVKVSPYLK-- 360
33241432  292 AEVSDIANAIYDGSSAVMLSGETASGAHPVAAVKIMRSVILETEKNLS---------HDSFlklDDSNSALQVSPYLS-- 360
62185258  292 AEVSDIANAIYDGTSAVMLSGETASGSHPIAAVKIMRSVIQETEKNLN---------YMSFleiNDSESAVKVSPYLQ-- 360
12045070  402 pKRKLvnsa----fkyDFIVYPTNNINRIYALSNARLAAAVIILTNNKRVYTGHGVDYGIFCYLIDKnpnqltKaELIEL 477
166154543 361 -AIGFsgiqiaekasaKAIIVYTQTGGSPMFLSKYRPYLPIIAVTPNRNVYYRLAVEWGVYPMLTLEs-------NRTVW 432
166155418 361 -AIGFsgiqiaekasaKAIIVYTQTGGSPMFLSKYRPYLPIIAVTPNRNVYYRLAVEWGVYPMLTLEs-------NRTVW 432
237802756 361 -AIGFsgiqiaekasaKAIIVYTQTGGSPMFLSKYRPYLPIIAVTPNRNVYYRLAVEWGVYPMLTLEs-------NHTVW 432
15618021  361 -AIGLagiqiaeradaKALIVYTESGSSPMFLSKYRPKFPIIAVTPSTSVYYRLALEWGVYPMLTQEs-------DRAVW 432
15835632  361 -AIGLagiqiaeradaKALIVYTESGSSPMFLSKYRPKFPIIAVTPSTSVYYRLALEWGVYPMLTQEs-------DRAVW 432
16752947  361 -AIGLagiqiaeradaKALIVYTESGSSPMFLSKYRPKFPIIAVTPSTSVYYRLALEWGVYPMLTQEs-------DRAVW 432
29840433  361 -SIGLsgiqiaekadaKAIIVYTESGGSPIFLSKYRPRFPIIAVTPNLSVYYRLALEWGVYPMLTQE------S-DRAVW 432
33241432  361 -AIGLagiqiaeradaKALIVYTESGSSPMFLSKYRPKFPIIAVTPSTSVYYRLALEWGVYPMLTQEs-------DRAVW 432
62185258  361 -SIGLsgiqiaekaaaKAIIVYTESGGSPIFLSKYRPRFPIIAVTPNLSVYYRLALEWGVYPMLTEEs-------DRTVW 432
12045070  478 AWKAINHYQAYGDLEKLKQCLAVYNETIINL 508
166154543 433 RHQACVYGVEKGILSNYDKILVFSRGAGMQD 463
166155418 433 RHQACVYGVEKGILSNYDKILVFSRGAGMQD 463
237802756 433 RHQACVYGVEKGILSNYDKILVFSRGAGMQD 463
15618021  433 RHQACIYGIEQGILSNYDRILVLSRGACMEE 463
15835632  433 RHQACIYGIEQGILSNYDRILVLSRGACMEE 463
16752947  433 RHQACIYGIEQGILSNYDRILVLSRGACMEE 463
29840433  433 RHQACIYGIERGILSNYDKILVLSRGAQMKD 463
33241432  433 RHQACIYGIEQGILSNYDRILVLSRGACMEE 463
62185258  433 RHQACVYGIERGILSNYDKVLVLSRGAQMKD 463
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap