Conserved Protein Domain Family
PRK05657

?
PRK05657: PRK05657 (this model, PSSM-Id:180185 is obsolete and has been replaced by 235548)
RNA polymerase sigma factor RpoS; Validated
Statistics
?
PSSM-Id: 180185
View PSSM: PRK05657
Aligned: 151 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 295676469  12 ESETISe-vTSAAVDESGaseveeEIAEERDLDERQGGLDd---sEGADARESTGDALpdaddfrallqaELTADTIQHY 87
gi 34499137    1 MSNEID-------------------ILDEDDILDEEGGEE-----NAAEAEAEESSEStav-------feDVVADVTQIY 49
gi 74316856    1 MSREHSd-eSDDLTPDETe-------------ADEERHAA-----SDSNEELASAILD------------EPQVDVTQLY 49
gi 300312263   1 MTSNRRd-hLPDQDPREEelddsvDEIDEPEVIDGDAGEE-----------VQEAAPAegvdelkkvlaaELSTDTTQHY 68
gi 119897381   1 --MEDPv-sSDELESHEPd--------------------------LPLEVEVFAEphap-------vfenDFLSDVTQIY 44
gi 152980760   1 -MTRNRd-vHAEDDENSDalsselSLQADDDAEKSDITDDdgdavELAERVAPVEVAGidelk--kvlatELSTDATQHY 76
gi 237653675   1 MEEPVNldeLESQQEPDLppevevFSFQAPPVVEN-----------------------------------EFFSDVTQLY 45
gi 82701632    1 -------mmNQQEYTDEE------ELFEKEDSLEQDDEAA-----DTPSSAITDTSND------------FLLTDVTQIY 50
gi 71908137    1 MSDTGEg-lEEEFEGQPDet-----------------------vlPPEPERVLPEIEL--------------LEDVTQLY 42
gi 134094484   1 MNHNRNaqaDDEENAGAVpvelsfQPVDDEEKADDADQGS-----DDVESHEPEALEVagidelkkvlssELSTDATQHY 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 295676469  88 LNRISVKPLLTVEEEQKYSRLAKAGEFEARQVMIERNLRLVVSIAKGYLNRGVPLLDLIEEGNLGLMHAIEKFDPTRGFR 167
gi 34499137   50 LNDIGNNALLTPQEELALARRVVAGEFEARQKMIEHNLRLVVNIAKHYINRGLALLDLIEEGNIGLMHALEKFDPERGFR 129
gi 74316856   50 LNEIGQAPLLTAAEEVALARRTVLGDFEARQTMIERNLRLVVNIAKHYANRGLTLLDLVEEGNLGLIHALEKFDPERGFR 129
gi 300312263  69 LNKIGAKPLLTAAEELHFATQAKAGEFVARQKMIEHNLRLVVSIAKHYINRGVALLDLIEEGNLGLMRAIDKFEPERGFR 148
gi 119897381  45 LNEIGANPLLSAEEEAALARRVRAGDFDARQTMIERNLRLVVNIAKHYLNRGIPLLDLVEEGNLGLMHALEKFDPERGFR 124
gi 152980760  77 LNQIGTRPLLTVPEEVHFATLAKQGNFAARQKMIEHNLRLVVSIAKHYINRGVILLDLIEEGNLGLMRAIDKFEPERGFR 156
gi 237653675  46 LNEIGANPLLTAEEELVIARRVRMGDFDARQTMIERNLRLVVNIAKHYLNRGIPLLDLVEEGNLGLMHALEKFDPERGFR 125
gi 82701632   51 FNEIGHNALLTPKEEAELTRRVRQNDFAARQKMIECNLRLVVNIAKHYTNHGVALLDLIEEGNMGMMHALDKFDPERGFR 130
gi 71908137   43 LSEIGAKPLLTPAEELATSRLVREGDFSARQRMIEHNLRLVVNIAKHYLNRGIPLLDLIEEGNLGLIHALEKFDPERGFR 122
gi 134094484  76 LNQIGARPLLTVPEEVHFATLAKQGNFAARQKMIEHNLRLVVSIAKHYINRGVVLLDLIEEGNLGLMRAIDKFEPERGFR 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 295676469 168 FSTYATWWIRQSIERAIMNQARTVRLPVHVIRELNQVLRAKRHLEKNsmnsgeaaERRDASIDDIAYLTGKTTDEVTDIL 247
gi 34499137  130 FSTYATWWIRQSIERAIMNQSRTIRLPVHVIKELNVYLRASRHLESQ--------IGREPSVEEIAHLVGKPVEDVRKVL 201
gi 74316856  130 FSTYATWWIRQNIERAIMNQSRTIRLPVHIIKELNIYLRAQRHLETH--------GVTDATSDDIAALTGHPVADVRRIM 201
gi 300312263 149 FSTYATWWIRQSIERAIMNQARTVRLPVHMVRELNQILRAKYHLEAQq------rDGRDASAEDIAHLVDRPVEEVQDVL 222
gi 119897381 125 FSTYATWWIRQNIERAIMNQSRTIRLPVHVVKELNQVLRAQRVVEAA--------SNGDFSLDEIARRLDKPIEEVRAIL 196
gi 152980760 157 FSTYATWWIRQSIERAIMNQARTVRLPVHVVRELNQTLRAKFHLEAQh------hDGKDATAEDIAHLVDRSVEDVQDIL 230
gi 237653675 126 FSTYATWWIRQNIERAIMNQSRTIRLPVHVVKELNQVLRAQRHIEAD--------CNGESSLEQIANRLGKTIEEVRSIL 197
gi 82701632  131 FSTYATWWIRQNIERCIMNQSRTIRLPVHVIKDLNIILQAARHLEAH--------TGKDPKAEDVAHLLGRTVKEVQRML 202
gi 71908137  123 FSTYATWWIRQNIERGIMNQSRTIRLPVHIVKEINVVLRAMRHLESA--------DKRDSTVERIALLIDRPVADVRRIL 194
gi 134094484 156 FSTYATWWIRQSIERAIMNQARTVRLPVHVVRELNQTLRAKFHLEAQh------hDGKDATAEDIAHLVERSVEDVQDIL 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 295676469 248 ALNEHTASLDAPLDLDPASSLLDLLSDDQSQSPDAEVQHRELETLTRAWLARLSDKHRHVIERRFGLNHIEPATLEELAD 327
gi 34499137  202 NLNERMASLDAPLDIDPMLSIGESIPDEQHEEPELQLHNSQLEMFVHDWLSQLNEKQRLVIERRYGLNGYEICTLEELAA 281
gi 74316856  202 QLNERIASLDAPLDVDPTLSLGEAIADDNAHLPDEMLQLEEIENHVQEWLTQLNDKQRWVIERRFGLNGCEACTLEDLAL 281
gi 300312263 223 ALSEHAASLDTPLDNDPQASLMDLLPSAVEEHPDTRAESQEMAVLIREWLKSLSEKQRVVVARRFGLDNDDPSTLEQLAS 302
gi 119897381 197 ALSEHTASLDAPLDIDPTLSIGESLADEHAETPESQIHNAEIEGLIRAWIDMLNDKQRLVIRHRYGIGECELMTLEELAA 276
gi 152980760 231 ALSEHATSLDAPLDGDPQSSLMDLLQGDHANDPDALAEHNEMTVLVHDWLEKLPDKQRLVITRRFGLDNDDPATLEALAA 310
gi 237653675 198 ALGEHTASLDAPLDIDPSLSIGESLADEQHISADLRIQCSEVEQLVREWLAILNDKQRMVIRHRYGIDECELLTLEELAE 277
gi 82701632  203 SLNQSMMSLDAPLDVDPLLSIGDAIADDQSPGPDLMWEQSEIKGRVQDWLNRLNDKQRYIIEQRYGLNGYETQTLEQLAA 282
gi 71908137  195 SLNEHIASLDAPLEIDPNHTMAEVIADDGESDPESLLQSSEVGSLVDDWLEQLTERQRSVIERRYGLSGADLATLDVIAC 274
gi 134094484 230 ALSEHASSLDAPLDGDPQSSLMDLLQGDHANDPDVLAEHQEMIVLVRDWLDKLSDKQRLVITRRFGLDNDDPATLEELAT 309
                        330       340       350
                 ....*....|....*....|....*....|....*
gi 295676469 328 EMGLTRERVRQIQQEALVRLKRFFASNGVRKDAVL 362
gi 34499137  282 SLNLTRERVRQIQIEGLEQLRRILRRKGISRDFLL 316
gi 74316856  282 ELEVTRERVRQIQMESLRVLRQLLRRRGVTKDELF 316
gi 300312263 303 EMGITRERVRQVQQEALIKLKRLLTSRGVGRDALF 337
gi 119897381 277 RLELTRERVRQIQLEALGQLRRILKRRGISRDVLF 311
gi 152980760 311 EMHVTRERVRQIQQEALVKLKRSLMRTGVGKDSLL 345
gi 237653675 278 RLELTRERVRQIQLEALGQLRRILRRRGISRDALL 312
gi 82701632  283 SLDLTRERVRQIQLEALQTLRMILRCEGVSKEGVF 317
gi 71908137  275 DLGLTRERVRQIQMEGLDRLRKIIKRGNISRDSLL 309
gi 134094484 310 EMHVTRERVRQIQQEALVKLKRSLARTGVSKDSLL 344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap