Conserved Protein Domain Family
PRK05572

?
PRK05572: PRK05572 
sporulation sigma factor SigF; Validated
Statistics
?
PSSM-Id: 180137
View PSSM: PRK05572
Aligned: 65 rows
Threshold Bit Score: 402.428
Threshold Setting Gi: 302874980
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 302874980   9 NSFNLENesSKQNNSINDYtDNVELIKLAQGGDNEALNDLIKKNMPLVAAISKKFLNRGYEYDDIFQIGCMGLIKAVNNF 88
gi 187934214   1 MGTE-----NFKREEFNYN-DNSQLLPLAKDGDNEAMNRLIEMNLPLVASISKKFLNRGYDYEDIFQIGSIGLVKAINNF 74
gi 188589198   1 MGTE-----NFKREEFNYN-DNSQLLPLAKDGDTEAMNRLIEMNLPLVASISKKFLNRGYDYEDIFQIGSIGLVKAINNF 74
gi 15895573    1 MGKENTL--KKEEPNYNDN---EKLIKSVHEGNKEALNKIIENNLPLVSAISRKFLNRGYEYDDIFQIGCMGLVKAVNNF 75
gi 18311030    1 MDIS-----SIEKDNFNYD-KNTTLIVMAKEGNKEAMNKLIEVNTPLVSSICKRFTNRGYDYEDIFQIGSMGLVKAINNF 74
gi 110799417   1 MDIS-----SIEKDNFNYD-KNTTLIVMAKEGNKEAMNKLIEVNTPLVSSICKRFTNRGYDYEDIFQIGSMGLVKAINNF 74
gi 28211847    1 MKFMSEG--VVKKSSYDYD-DNILLLEKAKNGDKKATDKLVELNLPLVSAISKKFLNRGYDYEDIYQIGCMGLVKAINNF 77
gi 150015700   1 MEKE-----DLKREDYNYD-KNPKLLALARSGDTDAMNTLIEMNLPLVSSISKKFLNRGYDYEDIFQIGSIGLVKAINNF 74
gi 300856558   1 MSEE-----TAKKLKYSYN-DNLELIKYAKKGDKDALNKLVELNLPLVASISKKFLNRGYEYEDIFQIGCMGLMKAVNNF 74
gi 118443643   1 -----MSesNAKGNSNNYE-INLELIKKAKLGDKKALDELVEKNLPLVTAISKKFLNRGYEYEDIFQIGSMGLIKAINNF 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 302874980  89 NTDFNVKFSTYAVPMIMGEIKRFLRDDGIIKISRSIKATAKKLHYDRENLTNILNREPTIEELSKYSGISKDDIIMATES 168
gi 187934214  75 DLSYNVKFSTYAVPMIIGEIKRFLRDDGMIKVSRNVKSLAKRIHFTKEELTKKLNRSPTIEELAEYSGVDKEEIIFAIES 154
gi 188589198  75 DLSYNVKFSTYAVPMIIGEIKRFLRDDGMIKVSRNVKSLAKRIHFTKEELTKKLNRSPTIEELAEYSGVDKEEIIFAIES 154
gi 15895573   76 NSDYKVKFSTYAVPMIMGEIKRFLRDDGIIKVSRSVKSTARQLHYDREKLVKELNREPTIDELSKFSGIDKEEIIMATES 155
gi 18311030   75 NDSFNVKFSTYAVPMIIGEIKRFLRDDGIIKVSRSTKTLAKKLHYNKEELIKKLNRDPTVDELAEYSGVDKEEVIVALES 154
gi 110799417  75 NDSFNVKFSTYAVPMIIGEIKRFLRDDGIIKVSRSTKTLAKKLHYNKEELIKKLNRDPTVDELAEYSGVDKEEVIVALES 154
gi 28211847   78 DSSYNVKFSTYAVPMIMGEIKRFIRDDGIIKVSRSLKIMARKLYYHRETLCKKLGREPSIEELSEYTGLEIEEIVYAMES 157
gi 150015700  75 DLNYNVKFSTYAVPMIIGEIKRFLRDDGMIKVSRNVKSLARKIHFQKEILTKKLKRSPTIEELADYANVDKEEILFAIES 154
gi 300856558  75 NEEYNVKFSTYAVPMILGEIKRFLRDDGMIKVSRSVKNTAKKIHYDREALTKKLNREPTIQELAEYSGVEVEELIFATES 154
gi 118443643  75 DSSYNVQFSTYAVPMIMGEIRRFIRDDGLIKVSRSVKYTARKLHFDKEKLTKKLNREPTVEELSKFSGIDKEQIIFATEA 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 302874980 169 SGSLQYLYDVIHQDDGSPVLLIDKISETGEDDkdMIDKLALKDALLKLDTKSRQIILLRYFKDKTQIQVAKMLGISQVQV 248
gi 187934214 155 ATSLQYLYDTIHQDDGAPVLLIDKLSEKGEDDigMINKIALKEALRSLDEKARQIIVLRYFKDKTQVQVAKLLGISQVQV 234
gi 188589198 155 ATSLQYLYDTIHQDDGAPVLLIDKLSEKGEDDigMINKIALKEALRSLDEKARQIIVLRYFKDKTQVQVAKLLGISQVQV 234
gi 15895573  156 TTSMQYLYDVVHQDDGSPVLLIDKLSDPYSEDsdVIDKIVLKQIIKSLDNKSKQIIMLRYFKDKTQTQVANMLGISQVQV 235
gi 18311030  155 ASSMQYLYDTIHHDEGTPVLLIDKLSEKGEDDd-MVNKIALREAISSLDSKGKQIIMLRYFKDKTQIQVAKMLGISQVQV 233
gi 110799417 155 ASSMQYLYDTIHHDEGTPVLLIDKLSEKGEDDd-MVNKIALREAISSLDSKGKQIIMLRYFKDKTQIQVAKMLGISQVQV 233
gi 28211847  158 SSNLQYLHDVIHQDDGAPIMLIDKISENYSEDsdIINKLALKEALGKLDAKSRQIIMLRYFKDKTQIEVAKMLGISQVQV 237
gi 150015700 155 SNSLQYLYDTIHQDDGAPVLLIDKLSEKSADDenLIEKIALKEALNSLDNKAKQIIMLRYFKDKTQVQVAKMLGISQVQV 234
gi 300856558 155 ASSLQYLYDTIHQDDGSPVLLIDKISENPKEDveMVDKIALKEALNNLDVKSRQIIMLRYFKDKTQVQVAKMLGINQVQV 234
gi 118443643 155 INEPKYLYDTIHQDDGSPIYLIDKVVLKDESEidELDKIALKEALSKLDQRSRQIIILRYFKDITQVKVAKMLGISQVQV 234
                        250
                 ....*....|....*..
gi 302874980 249 SRIEKKVLKLMKITLDG 265
gi 187934214 235 SRIEKKVLLRMREKLEE 251
gi 188589198 235 SRIEKKVLLKMRDKLEE 251
gi 15895573  236 SRIEKRILKAIREKLTK 252
gi 18311030  234 SRIEKKVLKIMKEKLEE 250
gi 110799417 234 SRIEKKVLKIMKEKLEE 250
gi 28211847  238 SRIEKRVLKTMKEKLGN 254
gi 150015700 235 SRIEKKVLAEMRKKLEE 251
gi 300856558 235 SRIEKKVLKTMREILTG 251
gi 118443643 235 SRIEKKVLKTMKEKLSG 251
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap