Conserved Protein Domain Family
PRK05309

?
PRK05309: PRK05309 
30S ribosomal protein S11; Validated
Links
?
Statistics
?
PSSM-Id: 180007
View PSSM: PRK05309
Aligned: 963 rows
Threshold Bit Score: 154.937
Threshold Setting Gi: 240047282
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PRK05309 is a member of the superfamily cl00332.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 217967394   3 KKKRTRGPKKEKRIVPVGVAHINSTFNNTIVTITDPEGNVLTWGSGGTAGFKGTKKGTPFAAQLAAEMAAKKAIsEYGMK 82
gi 218550573   2 AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVK-EYGIK 80
gi 254163225   2 AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVK-EYGIK 80
gi 161506030   2 AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVK-EYGIK 80
gi 24114575    2 AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVK-EYGIK 80
gi 30065402    2 AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVK-EYGIK 80
gi 82545660    2 AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVK-EYGIK 80
gi 187730089   2 AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVK-EYGIK 80
gi 82778593    2 AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVK-EYGIK 80
gi 74313816    2 AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVK-EYGIK 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*....
gi 217967394  83 KVDVLVKGPGPGRETAIRALQAAGLEISLIKDVTPIPHNGCRPPRRRRV 131
gi 218550573  81 NLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 129
gi 254163225  81 NLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 129
gi 161506030  81 NLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 129
gi 24114575   81 NLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 129
gi 30065402   81 NLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 129
gi 82545660   81 NLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 129
gi 187730089  81 NLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 129
gi 82778593   81 NLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 129
gi 74313816   81 NLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap