Conserved Protein Domain Family
PRK01889

?
PRK01889: PRK01889 (this model, PSSM-Id:179346 is obsolete and has been replaced by 234988)
GTPase RsgA; Reviewed
Statistics
?
PSSM-Id: 179346
View PSSM: PRK01889
Aligned: 73 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89894491    1 MNCQYELKELGWNDAWQEFFQPYLkSGFHPGRVAAEYRDRFKVWTEFGEVWAVVSGkmrytaleRSDFPAVGDWVVLEgr 80
gi 226303746   2 PENSTPLTEYGWNATLSNTFTTLApPDSAPGRVLRVDRGRCDVAVAEGTVRALSGSdp-----rGASQLCTGDWVTVAev 76
gi 111021095   1 MFDPGQLLPYGWNDTLSDTFDNYPaDGREPGRVIRVDRGRCDVATPAGIVRALA----------GEHTLCTGDWVTLHrh 70
gi 134103475  13 ADAVSSLSAYGWDDDLETSFAPHRrAGLVPARVVGVDRGRCDVVTGAGPLRVAFS---------AADGPCTGDWAAVRpa 83
gi 21224475    7 HSNHSALSSYGWDDSWADAFAPYAaEGLLPGRVVRVDRGQCDVVTADGVLRADTAFvtp---hdPLRVVCTGDWVAVEpg 83
gi 290956440  10 SISPHPLALYGWDEGWEAEFAVHAeQGLLPGRVVRVDRGQCDVVTPAGLLRADTAFvtp---hdPLRVVCTGDWVAVEpa 86
gi 29828628   16 SSSSHPLVPYGWDADWEAEFAPYDsEGLLAGRVIRVDRGQCDVVTPGGMLRADTAFvtp---hdPMRVVCTGDWVAVEpa 92
gi 182433950   1 ------MADYGWDAERERSFGPSRdEGLVPGRAVRAERGLCDVVAETGPVRAMVLPssg---tgDRLTPCTGDWVSVRpa 71
gi 271969326   7 DPSDAGLSRYGWTETLDNAFVEHReAGLVPARIARVDRGLCDAVTESGPVRAALTAlys---pdPLLAPCTGDWAALRw- 82
gi 297560780   8 HAQPYSLTDYGWDRARERAFTPRRaDGLIPARVVRADRGSCEVVTDTGTVRADVPGaad--rsdPLTAPCTGDWAALRpl 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89894491   81 aesikdhedQDVIIQSILPRKSKFSRKAAGKTSAEQIVATNIDTVFLVNALNFDFNVRRIERYLTLAWESGANPVLVLSK 160
gi 226303746  77 ln---srepEMHTVTSILPRSSSIVRSSASGKSEGQILAANVDTVVIATASDGDVDLGRIERLLALAWESGATPVVALTK 153
gi 111021095  71 --------gDDIAVADLLPRRSAIVRSSSSGRSEGQLLAANVDTVVIAAALDTALDLGRIERLLALAWESGAQPVVALTK 142
gi 134103475  84 -------sgGEPALVALLPRRTAIVRAGSSRSSHGQVLAANVDTVAVVVSAAVRLNAGRVERLLALGWESGAVPVVVATK 156
gi 21224475   84 --------gNPRYVRTYLPRRTAFVRSTSSKRSEGQILAANVDHAVVAVSLAVELDLARIERFLALAWESGAQPLVVLTK 155
gi 290956440  87 --------gDPRYVRTCLPRRSAFVRSTSSKRAEGQILAANVDHAVVAVSLAVELDLGRVERFLALAWESGAQPVVVLTK 158
gi 29828628   93 --------gDPRYVRTYLPRRSAFVRSTSSKRSEGQILAANVDYAVVAVSLAVELDLGRVERFLALAWESGAQPVVVLTK 164
gi 182433950  72 g------paTSATVVEVLERRTAVVRSTSSRTSHAQVLASNVDTVAVAVSLADPLKLGRIERTLALAWESGATPVIVLTK 145
gi 271969326  83 --------gREPELVALLPRRSAIVRSSASRTSHAQVLAANVDTVVLAVSLTTPLDAARLERLLALAWDSGARPLIVLTK 154
gi 297560780  86 -------tgAAPLLHEVLERRTTLVRASASRTSHGQLLAANVDTVVVTVSLAAPLKHGRTERMLALAWESGAQPVVVLTK 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89894491  161 TDLCDD---VQEKVSQVQDAAPGVDILPISCATGDGVSAIAPYIRQGqTIALLGSSGAGKSTLVNYLL----GQNVQLTY 233
gi 226303746 154 SDAAQY---ISDTLAEVSAIAPGATVLAVSAETNEGMDVLDAVLDG--TVAILGPSGAGKSTLANALLadttGADRLETG 228
gi 111021095 143 SDTVQD---VSPATAEVAAVAPGATVLAVSADTGDGIDVLTAVIDG--TVALIGPSGTGKSTLANALL----GEDVLATG 213
gi 134103475 157 ADQAAD---PGGLTAELADLAPGAEAVATSAVTGEGLDRLRRLLTG--TVVLLGASGAGKSTLANALL----GADELATG 227
gi 21224475  156 ADLVPDpvtLAYLVQDVETAAPGVPVLPVSAEQGEGLDVLAAVVSGG-TAVLLGQSGAGKSTLANALL----GEAAMDVQ 230
gi 290956440 159 ADLVPDaatLAHLVQDVETVAPGVAVLAVSSAHGEGLDVLAAVLSGG-TSVLLGQSGAGKSTLANALL----GENVMDVQ 233
gi 29828628  165 ADLVPDattLSYLVQDVETAAPGVPVLSVSSNLGEGLDVLAAVLSGG-TSVLLGQSGAGKSTLANALL----GEDVMKVH 239
gi 182433950 146 ADRSTD---PASAASEVAEAAPGVEVLVTSATTGEGLDILTAVLSG--TVVLLGPSGAGKSTLGNRLL----GEDLLATG 216
gi 271969326 155 ADLAAD---AAAVHAETSTLAPGVDILITSAATGQNIDVLTALLSG--TTVLLGSSGAGKSRLGNALL----GDELLATG 225
gi 297560780 159 ADACAD---LPSAQEQVSQVAAGVDVLVTSAETGQGLDVLAAALNG--TVVLLGPSGAGKSTLGNRLL----GQDLLATG 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89894491  234 EVREKDSRGRHTTTSRELFLLPQGGVLIDTPGMREIQLFGSGEGLSEAFEDIAAYAGNCRFSDCQHESEPGCAVQKAIAE 313
gi 226303746 229 RVRTGDGKGRHTTVTRELIPFSGARTLIDTPGLRGVGMWNAAEGIDKTFPEIEELIAECRFSDCAHNSEPGCAVLTALGR 308
gi 111021095 214 RVREGDHKGRHTTTHRELLPLPSGGALIDTPGLRGVGMWDTSDGIDKTFPEIEELAARCRFADCSHTAEPGCAVQGAVEH 293
gi 134103475 228 AVRAQDGKGRHTTVRREMVPLPEGGVLIDTPGLRGVGLFGAEEGLERTFAEIEELALGCRFTDCVHHTEPGCAVLAAIES 307
gi 21224475  231 AIRDVDGKGRHTTTTRNLLALPGGGVLIDTPGLRGVGLFDAGNGVDQVFAEIAELAEECRFHDCAHESEPGCAVLAAIDS 310
gi 290956440 234 AIRDVDGKGRHTTTTRNLLALPGGGVLIDTPGLRGVGLWDAESGVGQVFAEIEALAADCRFHDCAHIAEPGCAVLGAVES 313
gi 29828628  240 ATRDVDGKGRHTTTTRNLLALPGGGVLIDTPGLRGVGLWDAETGVNQVFSEIEALAAECRFHDCAHTAEPGCAVLAALDT 319
gi 182433950 217 EVRGSDGKGRHTTAWRELVPLPHGGVLLDTPGLRGVGLHDADDGLEHTFAEITELARDCRFADCAHTTEPGCAVLAAVED 296
gi 271969326 226 EVRAQDGKGRHTTVRRELVPLPGGGVLIDTPGLRGISLYDAADGLEQVFAEIERLAQDCRFGDCSHDTEPGCAVQAAIQA 305
gi 297560780 230 AVREADGRGRHTTSRRELLPLPGGGVLLDTPGLRAIGLHDSRGGLEQTFAEIEHLAQECRFTDCSHTSEPGCAVLAAVEG 309
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
gi 89894491  314 GMLSEERYESFKKLQREARYISRKTNLHeqLEEKKKWKKITQQIKEHYQT-KR 365
gi 226303746 309 GDLDERRLASYRKLQRENAWNAARSNARlqAERTREIKVISRHLKSHYRGrDR 361
gi 111021095 294 GELPERRLASYRKLIRENGWIASRTDARlrAEREREWKSIARWQRQMYRSrGH 346
gi 134103475 308 GEISARRLDSYRKLQRENAWMAARSDARlrAEREERWKVITKQQRAAYRFrGK 360
gi 21224475  311 GALPERRLESYRKLMRENQRIVAKTDARarAEIRKEYKRRGAIGKAAMEA-KR 362
gi 290956440 314 GELPERRLDSYRKLLRENQRIVAKSDARvrAEIRKDWKRKHAEGRAAMEA-KR 365
gi 29828628  320 GELPERRLDSYRKLLRENQRIVAKTDARlrAEIRRDWKRKGAEGKAAMEA-KR 371
gi 182433950 297 GRLTQRRLDSYHRLQRENTYAAARTDARlrAELERPMKQISRQVRALKQSpHF 349
gi 271969326 306 GELTERRLGNYRKLQRENAWAASRTDARlrGERTNQQKAITSHLRATYKF-RD 357
gi 297560780 310 GEIPRRRLDSYHQLLRENAYAASRTDARlrADREAARKDITRHLRATYRF-RD 361
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap