Conserved Protein Domain Family
PRK00093

?
PRK00093: PRK00093 (this model, PSSM-Id:178858 is obsolete and has been replaced by 234628)
GTP-binding protein Der; Reviewed
Statistics
?
PSSM-Id: 178858
View PSSM: PRK00093
Aligned: 871 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78776593    1 MKKIAIIGRPNVGKSSLFNRLMKKRDAITSDVAGTTRDVKRRHVVIINKEALLLDTGGLDQ--GCE--LFDKIKEKSLEA 76
gi 108759687   2 KPLVAIVGRPNVGKSTLFNRLVGRRIALVQDEPGVTRDRHYADAEWEGRQFTFIDTGGFVP--GDEdqLLQQVREQAQLA 79
gi 158522145   2 KPVVVILGRPNVGKSTLFNRLTRTQNALVDDMPGVTRDRLYGDVEWNGVFFSLVDTGGFLS--GDDdfFMPHIQSQIHRA 79
gi 224370723   2 KPVVALVGRPNVGKSTLFNRITRSRNALVDDFPGVTRDRHYVDAVWNERPFTLVDTGGFLL--SDDdfFAREIRGHVELA 79
gi 153005016  10 RALVALVGRPNVGKSTLFNRLAGRRAAIVQDVPGVTRDRNYADFSFDGRALSVVDTGGFEP--ESRdrLMSQVRQQAQLA 87
gi 189425185   2 KSIVAIVGRPNVGKSTLFNRIVGERRAIVDDMPGVTRDRNYAVVERYDKPFILVDTGGFEP--VTEdrMLQQMREQSLLA 79
gi 197122609   5 RPVVALVGRPNVGKSTLFNRLAGRRVAIVEDVPGVTRDRNYADVIWEGRAVSVVDTGGFEPe-SRDr-LMSQVREQAQLA 82
gi 218781934   1 MALLAIMGRPNVGKSTLFNRITKSRKAMVDDSPGVTRDRNYADAEHDGVKFSVVDTGGFSK--NDPdaFVDLIHFQVNQA 78
gi 220917392   5 RPVVALVGRPNVGKSTLFNRLAGRRVAIVEDVPGVTRDRNYADVIWEGRAVSVVDTGGFEPesRDr--LMSQVREQAQLA 82
gi 85860147    4 NTIVAIVGRPNVGKSTLFNRLSQKSKAIVIDVPGATRDRNYADCTWHGRRYTLIDTGGFEP--ASTetILIQMREQTHLA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78776593   77 AKKADIILYMVDGKSIPEDADKKLFYELQTLGKEVALVVNKIDndKL----KDNLWDFYEFGTDAIFGISVSHNRSVNAL 152
gi 108759687  80 VDECDVIVFVTDARAGLTAADEAVANYLRKSGKPVVLAANKLD--NTsgqmQALAGEFYRLGLGDVQALSAEHGLGMQEL 157
gi 158522145  80 IDEADAVLLVFDGKSGISPFDREAMAFLQSASCPVFYLVNKID--SPe--rEVYTAEFFGLGLDNLYPVSGAHGYGVTDF 155
gi 224370723  80 IEDADIVALVLDGRAGISPFDRDLADILRRTSKPVFFLVNKVE--NHk--qREELLEFYSLGIEKFYPMSAEHGIGVEPF 155
gi 153005016  88 VEEAAAVVLVVDGREGLTAVDRSVADLLRRAGKPLFVAVNKVD--TArteeEIPLAEFYQLGFGEVHSVSAEHGRGVGDL 165
gi 189425185  80 MEEADVILFLMDAKQGLTPADNEVASMLRRVDKPVFYVVNKVD--GEk--vENEAAEFYALGIDNMHTISAAHNRGIRDL 155
gi 197122609  83 VDEASAVVLVVDGRDGLTALDRNVADLLRRAGKPLFVAVNKVD--TArteeDVPLAEFYGLGFGEVHAVSAEHGRGVSGL 160
gi 218781934  79 IEEADAIAMVFDGKDGPSPFDRDLLSVLRPLDKPIFYLVNKID--SLd--mEYLMADFAELGVDKLHPVSGEHGYGVPTF 154
gi 220917392  83 VDEASAVVLVVDGRDGLTALDRNVADLLRRAGKPLFVAVNKVD--TArteeDVPLAEFYGLGFGEVHAVSAEHGRGVSGL 160
gi 85860147   82 IEEADIIIFLMDGRDGLTPADIEIVQLLREGGKKVFYAVNKVD--GPr--hEGLLPEFYRLGVSRIHDISAQHGLGIDEL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78776593  153 LEWIYD----------------------------RLPEEDIIKDedeeddvniveeddeefefddkeyneeeEDdnffyp 204
gi 108759687 158 FDSVVArlppkeege-----------------daeappddGI-------------------------------------- 182
gi 158522145 156 LDDLVNalpetep------------------------------------------------------------------- 168
gi 224370723 156 LDDMVAlfpapepvvepqa------------------------------------------------------------- 174
gi 153005016 166 VEAIVEklqlpeappapedv-------eepeevteadrpkGD-------------------------------------- 200
gi 189425185 156 LDEIMAllpdepl------------------------------------------------------------------- 168
gi 197122609 161 VDAIVEklalppl--------------ppapeeaDEPQEVSEAEr---------------------------PV------ 193
gi 218781934 155 LDMVVKvlpkasp------------------------------------------------------------------- 167
gi 220917392 161 VDAIVEklalpplppapeeadepqevseaerpvgD--------------------------------------------- 195
gi 85860147  158 MEDLSAclpeeaasa----------------------------------------------------------------- 172
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78776593  205 eddedeefeddsifaqndrikefdetdAnHIKISIIGRTNVGKSSLLNALLGEERSVVSSVAGTTIDPIDESMEYKDKQL 284
gi 108759687 183 ------------------------------IRLAIIGRPNVGKSTLVNAILKEKRVVASDVAGTTRDPVDSELTYKDRKL 232
gi 158522145 169 -----------------------eppaddmIKLAVVGRPNVGKSTLINRILGQERMIVSDVPGTTRESVDTVCEIDGRSY 225
gi 224370723 175 -----------------gseqgepdaseqeICIAVAGRPNVGKSSLINRLFGKSRVVVSHVPGTTRDSVDLSIERNGRRF 237
gi 153005016 201 ------------------------------IRLAIVGRPNVGKSTFVNSLLGHERFVVSDVPGTTRDAIDSLVEQRGQRF 250
gi 189425185 169 ------------------------pgedevTNIAVVGRPNVGKSSLVNRLLGFERVVANPVAGTTRDSVDTFFTCNKKRY 224
gi 197122609 194 ---------------------------G-DIRLAIVGRPNVGKSTFVNALLGEERFVVSDVPGTTRDAIDSLVAHKGRRF 245
gi 218781934 168 ------------------------kleedmISIGVVGRPNAGKSSLINKILGQERLLVSDTPGTTRDAVDTVCQVNGKPY 223
gi 220917392 196 ------------------------------IRLAIVGRPNVGKSTFVNALLGEERFVVSDVPGTTRDAIDSLVAHKGRRF 245
gi 85860147  173 ---------------------geegeeedrIRIALIGKPNVGKSSLLNKILGYERTIANPTPGTTRDAIDTPFEFDGHRY 231
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78776593  285 TFVDTAGLRRRGKIV-GIEKFALMRTKEMLENSNMALVVLDASEPFLDLDEKIAGLVDSNRLACIIVLNKWDIA--NRDE 361
gi 108759687 233 LLTDTAGIRRKKSIAqRVEQFSVVAALKVMERSDVAVLLMDATEPAVDQDAKLAGLAEERGRALVIVVNKWDLVgaDQRR 312
gi 158522145 226 LLIDTAGLRRKSRVSvKLEKFSAIKTLKSLDRCDIALILVDAEEGVTDQDVTIAGYAFERGCGCIFLVNKWDLAkeQEKK 305
gi 224370723 238 RLIDTAGIRRKGKVReRIEKYSILKSLKSLDQCDVALILIDADEGVTDQDITIAGYAQDRGCGALFLINKWDLLdeDRKD 317
gi 153005016 251 VVTDTAGIRRKSAIAqAVEAYSVVRSMKAIDRAEVVACLLDATEAGVEQDARLLGLIAEKAKALLVVINKWDIAerEGAT 330
gi 189425185 225 CLIDTAGIRRKGKTSqKLEKYSVVDALKSIERADVALIVLNAEDGITEQDKHIAGYVYEAGRACVFVVNKWDTLekDNKT 304
gi 197122609 246 VVTDTAGIRRKRSIAlKVESFSVVRAMKAMDQAEVVACLLDATEAGVEQDARLLGLVAEKGKALVIVVNKWDIAerEGAT 325
gi 218781934 224 LLLDTAGIRRKGKVKhKLEKFSIVRALKGLERCDVALVMLDATEGITDQDVHIAGYAEERKCGCIFLANKWDLV---KDK 300
gi 220917392 246 VVTDTAGIRRKRSIAqKVESFSVVRAMKAMDQAEVVACLLDATEAGVEQDARLLGLVAEKGKALVIVVNKWDIAerEGAT 325
gi 85860147  232 LLIDTAGIRKKSRISlSLEKYSVIQALKTLDRCDIALLLIDAEEGITDQDTKIAGLAFEKGRAVIIVVNKWDLVakDNST 311
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78776593  362 ---YDKIIQEVRDRFKFLAYAPIVTLSAKSHRRVDKLFDMILEIDKNYSQHIKTSELNVVLEKALRRHQLPSMRGQIIRI 438
gi 108759687 313 ---QETYRESLKHSLKFVGYAPILFTSALTGSKVEKVVDVATELADQFRFRAPTPQLNRLLDHMVDNHPAPIVRGKPLRM 389
gi 158522145 306 ---AKTFYDDLQDQAKFLSFAPAVTISAATGFRVKKIFELIDAVHAQYTFNIKTGELNNIFERATRSKEPPFHKGRRLKF 382
gi 224370723 318 ---QRRFMEDLRTKSKFLSFAPAMTISALTGFRTHKILAMVEKIHAQYAYRINTGLLNRIVEDAIFRSEPPMHKGKRLKF 394
gi 153005016 331 ---QDWYRKELHKRLPFVSFAPMLFVSAKEGRGVTRVLDRAARLVEQYRARFPTPALNELLEAIQEEHPAPLAKGHPVKL 407
gi 189425185 305 ---IGKFVEQIQYEFKFLAFAPIVFVSARTGQRIHKVMEEAAEVAEQYSRRVTTSELNRVFKEAVEAHHAPLHHARRVKF 381
gi 197122609 326 ---QDWYRKELTKRLPFVGFAPMLFVSAKERRGVHRVLEKAARLVEQYRARFPTPQLNELLEALQDEHPAPIARGRRVKL 402
gi 218781934 301 dwaLKKIKDEVRMNAKFLNYAPFMTISALTGQRVNRIFELVDKVYAQYTTRISTSKLNRMLENAITRHEPPYHKGRRLKF 380
gi 220917392 326 ---QDWYRKELTKRLPFVGFAPMLFVSAKERRGVHRVLEKAARLVEQYRARFPTPQLNELLEALQDEHPAPIARGRRVKL 402
gi 85860147  312 ---VGRYVRDIKDRLKFMDFSPIIFVSALSGQRVTRIFALVQEVYRQYTTRISTGELNRKVMEIVSKNPPPQYQQKAHPF 388
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 78776593  439 YYATQYETRPPKIAIVMNKPRGLHFTYRRYLTNKLREAFSFSGTPVLFKAK-KRG 492
gi 108759687 390 YYIAQVAAAPPTFTITVNHPDGVPDMYKRYITNQLRKTFDL-RVPIRLIFK-GRP 442
gi 158522145 383 NYAVQVATGPPTFICFVNFPSGVHFSYKRYLINAIRRETGLDKTPIRLFFReKPG 437
gi 224370723 395 FYATQVAVKPPTIVCFVNYPDAVHFSYHRYLVNQIREMAELEHTPIRLLFRaKTG 449
gi 153005016 408 YYVAQVAYAPPTFVIQCNRPEAIGEPYRRFVENRFRDAFGL-DVPMRLVFReRKR 461
gi 189425185 382 YFATQVGVKPPTFAIFTNQPDGVLTPYQRYLGNRFRDAFGFKGTPFRLLFRgRER 436
gi 197122609 403 YYVAQVAYAPPTFVIQANHPDGLTDHYRRYIENRFRDAFGL-EVPMRLVFKeRQH 456
gi 218781934 381 YYATQVSTKPPTIVCFVNHPDAVHFSYKRFLINHIREETGLDQTPIRLLFR-QRD 434
gi 220917392 403 YYVAQVAYAPPTFVIQANHPDGLTDHYRRYIENRFRAAFGL-EVPMRLVFK-ERQ 455
gi 85860147  389 NYVTQVSIKPPTFAFFVGKPAEIHFSYERYLINSLREALGFTTVPIRLVFR-RKH 442
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap