Conserved Protein Domain Family
lpxB

?
PRK00025: lpxB (this model, PSSM-Id:178802 is obsolete and has been replaced by 234580)
lipid-A-disaccharide synthase; Reviewed
Statistics
?
PSSM-Id: 178802
View PSSM: PRK00025
Aligned: 321 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157964398   1 MTKIYFIAGEVSGDFVGGRIIQHLKNNTevqlnspvssfvnDAVQFVGVGDKYMEEAGsFKSLFPITSINLMGFVEILPH 80
gi 189423836   6 PKRVMIVAGEASGDIYGAGLVRAVQAAD-------------PAFSFFGIGGPRMREAG-CETLVDSADMAVVGLVEVLKH 71
gi 78223553    6 NKRVMIVAGEASGDLHGSNLVKEALRLD-------------PTLSFFGIGGPHMRAAG-VETVVDSSEMAVVGLVEVLAH 71
gi 39997359    6 SHRIMIVAGEASGDLHGAGLVREALRLD-------------PTLSFFGIGGPRMREAG-VETLVDSSEMAVVGIVEVLAH 71
gi 118581429   3 ERRVMIVAGEASGDIYGAQLASETARLS-------------PNIRFFGIGGERMREAG-VQTLVDSADMAVVGLVEVLRH 68
gi 253702009   5 GKSVMIVAGEASGEMYGASIASEIRTLA-------------PQTRFFGMGGGNMRRAG-VETLVDADTMAVMGLVEVLAH 70
gi 197117236   5 PKSVMIVAGEASGEMYGASIATEIRALA-------------PETRFFGMGGGNMRKAG-VETLVDADTMAVMGLVEVVAH 70
gi 148265260   1 ----MIVAGEASGDMYGAMLAREIRRLD-------------RDIAFIGMGGAGMRAAG-VETLIDANDMAVVGLVEVVAN 62
gi 222055196   5 ARKIMISAGEASGDMYGAVLAREISALD-------------FKTAFIGMGGPGMRAAG-VETVVDANEMAVVGLVEVIAH 70
gi 77918862    7 PRRIMVVTGEASGDLHGAHLIEAAGKVD-------------PGLSFFGVGGACMAKAG-CEILIPGEDLAVMGLVEVLGH 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157964398  81 IFKLKKLIDKTVEDII-NSKADLLITIDSPGFTYRVAKRVRKLlpKLKMIHIVAPSVWAYKEGRAVKYAKIYDCLFALLP 159
gi 189423836  72 FDVIAAAFLKLKKILL-EDPPDLLILIDYPGFNLRLGKVAKKA--GVKVLYYISPQIWAWRQGRVKKIKRLVDHMAVILP 148
gi 78223553   72 FGVIYKAYATLKRLIT-TNPPDLLILIDYPDFNMLVAKVAKRA--GVKVLYYISPQVWAWRTGRVKKIARLVDRMAVVFP 148
gi 39997359   72 IGVISRAFMTLRQVIV-SNPPDLLILIDYPDFNMLLARVARRH--GVKVLYYISPQVWAWRTGRVKTIGRLVDRMAVVFP 148
gi 118581429  69 FDVIAKAFLKLKRILL-QTPPHLLVLIDYPGFNLRLARVARRS--GVRVLYYISPQIWAWRQGRVHEIARLVDHMAVIFP 145
gi 253702009  71 LPVIVNGFNTLKNKLR-SDLPDLLILIDYPDFNLRLAKVAKKA--GVKVLYFISPQVWAWRSGRVKGIGRVVDMMAVLFP 147
gi 197117236  71 LPVIVNGFNTLKNKLR-SDLPDLLILIDYPDFNLRLAKVAKKA--GVKVLYFISPQVWAWRSGRVKGIGRVVDMMAVLFP 147
gi 148265260  63 FRVIANAFTSLKRVIK-TTPPSLLILIDYPDFNLRLAAVAKAC--GVKVLYYISPQVWAWRAGRVKKIARIVDHMAVLFP 139
gi 222055196  71 FPVIVKAFNTLKNILH-SDPPDLLILIDYPDFNLRLAKVAKKA--GVKVLYFISPQVWAWRAGRVKKIGRVIDQMAVLFP 147
gi 77918862   73 FPTIWRAFRKLKKILHgPQRPDALVLIDFAEFNLLLAAQAKKA--GVPVLYYVSPQVWAWRRGRVRRIASVVDRLAAIFP 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157964398 160 FEPPYFTKVGLDCRYIGHPIMEQEFY-SDKIALREEFKIDENERVLCVTLGSRKGEILRHVSVFVSSIEEIFKSCNNLKV 238
gi 189423836 149 FEVPFYEQAGVPVSFVGHPMADLVEVsLTRDQAATSFGLDTSRQIVGLFPGSRRSEVSRLLPTILEAARLLQQCLPGLQF 228
gi 78223553  149 FEVPFYEKAGVPVSFVGHPLADRVSPsMSRSEALAAFGLDPSRRVVGLFPGSRRGEIARLFPVILESAKLLRDRYPGIQF 228
gi 39997359  149 FEVPFYERAGVPVSFVGHPLADRVRPtMGRDEALASFGLDPGRRVVGLFPGSRRGEIAKLFPVILESAQQLRERYPDIQF 228
gi 118581429 146 FELPFYRNAGVAASFVGHPLYDLVAVeASRDQAAASFGLDPSRRILGLFPGSRRSEVQRLLPVIVQAAALLKQCYPDLQL 225
gi 253702009 148 FEVPFYQNAGVPVTFVGHPLLDLVRPtMKRDEALSSLGLDPGRRCVGLFPGSRKSEIGKLLGIILEAAGILKERMPELQF 227
gi 197117236 148 FEVPFYQNAGVPVTFVGHPLLDLVRPtMKRDEALSSLGLDPQRRCVGLFPGSRKSEIGKLLGIILESAEILKKRMPELQF 227
gi 148265260 140 FEVPYYEKERVPVTFVGHPLLDMVRPtMGRAEAVSFFGLDPHKKTIGLFPGSRRSEIKSLFPVILESAKLLQSRFTDVQF 219
gi 222055196 148 FEVPYYEREQVPVTFVGHPLLDMVRPtMTKAEATTKFGLADGRRVIGLFPGSRRGEIKSLFPVILQSARLLKDRHPDIEF 227
gi 77918862  151 FEPELYQGLDIDVEYVGHPLLDEFAItCERDAFLRRLGLDPARQVIGLFPGSRKNELKYIAETILQSAVKLREKHPDAQF 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157964398 239 IFTLANPAHEAIIKPFLED--VKfNYLFSSERLKTYAVADVALAKSGTNTLEIAASGTPMIVAYKVNLisfFIIRLLIKI 316
gi 189423836 229 VLPLASTLSDDDLAPWLEGceLP-ITVTRDRIHDLMRACDAVISVSGTVTLEIALVGTPLVIIYKLSPltfQLAKRLVKV 307
gi 78223553  229 ILPLASSLTDADIAPHLAAsgLE-VVVARDKVYDVMQVCDAIATVSGTVTLEIALMGVPMVIIYTVSPltyEVGKRLIRV 307
gi 39997359  229 ILPLASSLTDGDIAPLLAAsgLD-VTVTQDRVYDVMQVCDAIITVSGTVTLEIALMGVPMVIIYKVSPltyQVGKRLIRV 307
gi 118581429 226 VLPLASTLGSEDIAPHLPs-dLP-VTITRDRIHDLIRGCDAIISVSGTVTLEIALLGTPMVVIYKLSPltyQLARRLVKV 303
gi 253702009 228 VLPLASSLRQEDLDPYLSAsnVE-VKVVSGRNHDVMTACDAAVCASGTVVMEMALVGTPHVIIYKMSGftyEVGKRVINV 306
gi 197117236 228 VLPLASSLRREDLDPYLSGskVE-VRVVSGRNHDVMTACDAAVCASGTVVMEMALVGTPHLIIYKMSTftyEVGKRVINV 306
gi 148265260 220 ILPLASSLKHADIAPELEKsgLQ-VFVVQDRNYDVMQVCDAVVTVSGTVTMEIALIGVPMVIIYRVSPltyAVGKRLIKV 298
gi 222055196 228 VLPLASSLKREELQPSLDAsgLE-IKVVENATHDVIQVCDAIITVSGTVTMEIAILGVPMVIIYKVSPftyAVGKRLIKV 306
gi 77918862  231 LLPVASSFRRQDIEALVAPygLP-VTVVDEPIYDVINACDAVISVSGTVTLQVALVGTPMAIVYKMAPlsfAIGKRLIRV 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157964398 317 KYVMLINIIADKEIIPEFIQFNCRANLISNKLQELLFNS---KKAYEQVIESQKILqQLGfkSNRlqlnsesfrhdefkg 393
gi 189423836 308 EHIGLCNIVAGETVARELIQEEASPEQIAGEIGRLLRDAeynTAFRERLTHVRERLgGGG--ADR--------------- 370
gi 78223553  308 DHIGICNIVAGERVVPELIQDEATAERIAAEIGRYLDDPvhtEKTRAGLARVREKLgSGG--CSE--------------- 370
gi 39997359  308 DHIGICNIVAGERVVPELIQDDASADRIAAEIGRYLDDPayaEKTRAGLAMVKEKLgTGG--CSE--------------- 370
gi 118581429 304 DNIALCNIVAGETVVRELIQDDASANGIAAEIGTILDDDayaGTIRAKLATVRSRLgRGG--AAR--------------- 366
gi 253702009 307 PHIGISNIVAEKRMVRELVQHEAEPLAIADEVDLLLNDAayaTEMREGFAAMRVKLgSGG--ALG--------------- 369
gi 197117236 307 PHIGISNIVAEKRMVRELVQHEAEPVAIADEVDALLNDAayaTEMREGFAAMRVKLgSGG--ALG--------------- 369
gi 148265260 299 DHIGICNIVAGERVVKELIQHDAEPAKIAAEIGAILTDSeyaAAITRKLGTIEQKLgSGG--CSR--------------- 361
gi 222055196 307 DHIGICNIVAGERAVKELIQHDAEPEKIAAEITAILEDTeyaIKIRKSLAAVPAKLgSGG--ALH--------------- 369
gi 77918862  310 PHIGLANIVAGRGVVKEFIQEDATPAMISREIDAILTDAeynRSIRGGLATVQQRMgEGG--CAA--------------- 372
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|.
gi 157964398 394 klarrtkvrehrlslenslvssnrddaVPSYIAAEIIKQEF 434
gi 189423836 371 ---------------------------RMAGLVLSMVEQS- 383
gi 78223553  371 ---------------------------RVAGIVLEMLGKKR 384
gi 39997359  371 ---------------------------RVAGIVLEMLGKQV 384
gi 118581429 367 ---------------------------NVARLILEMVEQS- 379
gi 253702009 370 ---------------------------RVARLAMEMMG--- 380
gi 197117236 370 ---------------------------RVARLAMEMMR--- 380
gi 148265260 362 ---------------------------RLAELALKMMD--- 372
gi 222055196 370 ---------------------------RVAQLALSLMRENE 383
gi 77918862  373 ---------------------------RVARMVSELCREIP 386
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap