Conserved Protein Domain Family
PLN02587

?
PLN02587: PLN02587 
L-galactose dehydrogenase
Statistics
?
PSSM-Id: 178198
View PSSM: PLN02587
Aligned: 14 rows
Threshold Bit Score: 586.359
Threshold Setting Gi: 168013997
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PLN02587 is a member of the superfamily cl00470.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 168013997   1 MWELGLTGLKVTSIGYGSSPLGNAYGYVAEEDAIASVHEAARLGIKYFDVAPSYGDTLAETVLGKALKTMPIPRESYVVS 80
gi 15235040    6 LRALGNTGLKVSAVGFGASPLGSVFGPVAEDDAVATVREAFRLGINFFDTSPYYGGTLSEKMLGKGLKALQVPRSDYIVA 85
gi 168048191   6 LRELGTTGLRVTSIGFGGSPLGNVFGAVKEEDAIASVHEAARLGINYFDVSPYYGDTLAETVLGKALKTMPIPRESYVVS 85
gi 225429064   6 LRDLGTTGLMLSCVGFGASPLGNVFGLVSEDDAIASVREAFRLGINFFDTSPYYGGTLSEKVLGKCLKAVGMPRNEYIVS 85
gi 224056323  11 LRPLGNTGLKLSCVGFGASPLGSVFGPVSEHDAISSVREAFDLGINFFDTSPYYGGTLSEKMLGKGLKALGVPRNEYIVS 90
gi 224103819  10 LRPLGNTGLKLSCVGFGASPLGSVFGPVSEHDAISSVREAFRLGINFFDTSPYYGGTLSEKMLGQGLKALGVPRNEYIVS 89
gi 255554531  10 LRALGDTGLKLSCVGFGASPLGRVFGPVSEDDAIASVREAFRLGINFFDTSPYYGGTLSEKMLGKGLKALGVPRDQYIVS 89
gi 297798560   6 LRPLGNTGLKVSAVGFGASPLGSVFGPVAEDDAVATMREAFRLGINFFDTSPYYGGTLSEKMLGKGLKALQVPRSDYIVA 85
gi 302809502   3 YTKLGSTGLEVSSLGFGGAPLGSVFGPVSQESAIESVREAIRLGINFFDVSPCYGN--AETVLGRALES--IPREKFVVS 78
gi 302794446   3 YTKLGSTGLEVSSLGFGGAPLGSVFGPVSEESAIESVREAIRLGINFFDVSPCYGN--AETVLGRALES--IPREKFVVS 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 168013997  81 TKCGRYGGGatteisFDFSAERVTRSVDESLARLKLDYLDIIFCHDIEFASLDQILNETIPALQAVKESGKVRHIGISGA 160
gi 15235040   86 TKCGRYKEG------FDFSAERVRKSIDESLERLQLDYVDILHCHDIEFGSLDQIVSETIPALQKLKQEGKTRFIGITGL 159
gi 168048191  86 TKCGRYGSG------FDFSAGRVTRSVDESLARLNLQYVDIILCHDIEFGSLDQIVNETIPALQKLKESGKIRHIGISGL 159
gi 225429064  86 TKCGRYAEG------FDFSAERITRSIDESLARLQLDYVDILQCHDIEFGSLDQVVNETIPALQKLKEAGKIRFIGITGL 159
gi 224056323  91 TKCGRYVEG------FDFSAERVTKSIDESLARLQLDYVDILQCHDIEFGSLDQIVNETIPALQKLREAGKIRFIGITGL 164
gi 224103819  90 TKCGRYVEG------FDFSAERVTKSIDESLARLQLDYVDILQCHDIEFGSLDQIVNETIPALRKLKEAGKIRFIGITGL 163
gi 255554531  90 TKCGRYVEG------FDFSAERVTKSIDESLARLQLDYVDILQCHDIEFGSLDQIVNETIPALQKLKEAGKIRFIGITGL 163
gi 297798560  86 TKCGRYKEG------FDFSAERVRKSIDESLERLQLDYVDILHCHDIEFGSLDQIVSETIPALQKLKQEGKTRFIGITGL 159
gi 302809502  79 TKCGRYSDG------FDFSAQRVLESVDESLERLKLDYIDIIHCHDIEFGSLDQVISETIPALLGLKRQGKVRFIGMSGL 152
gi 302794446  79 TKCGRYSDG------FDFSAQRVLKSVDESLERLKLDYIDIIHCHDIEFGSLDQVISETIPALLGLKRQGKVRFIGMSGL 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 168013997 161 TLFSCRYVLDRAPEGAVEVVLSYAHHSLNDTSLLELLPYLKSKGVGLINASPLSLGLLTEKGTPHWHPAPLEIKTICAQA 240
gi 15235040  160 PLDIFTYVLDRVPPGTVDVILSYCHYGVNDSTLLDLLPYLKSKGVGVISASPLAMGLLTEQGPPEWHPASPELKSASKAA 239
gi 168048191 160 PLNIFKYVLDRVPKGSVEVILSYCHYSLNDTSLLELVPYLKDKGVGIISASPLSMGLLSGLGYPDWHPAPPELKAACAQV 239
gi 225429064 160 PLEIFTYVLDRVPPGSVDVILSYCHYSINDTTLEDLLPYLKSKGVGVISASPLAMGLLTERGPPEWHPASPELKSACQAA 239
gi 224056323 165 PLSVFTYVLDRVPPGTVDVILSYCRYSVNDSTLVDLLPYLKSKGVGVISASPLAMGLLTENGPPEWHPASAELKSACQAA 244
gi 224103819 164 PLGVFTYVLDRVPPGTVDVILSYCRYSINDSTLADLLPYLKSKGVGVISASPLAMGLLTENGPPEWHPASPELKSACEAA 243
gi 255554531 164 PLGVFTYVLDRVPPGAVDVILSYCHYSINDSTLEDLLPYLKSKGVGIISASPLAMGLLTETGPPEWHPASPELKSACQAA 243
gi 297798560 160 PLDIFTYVLDRVPPGTVDVILSYCHYGVNDSTLLDLLPYLKSKGVGVISASPLAMGLLTEQGPPEWHPASRELKSACKAA 239
gi 302809502 153 PLAIFRYVLDRVEPGTVDVILSYCHYSLNDSSLEGLIPYLKDKGVGIITASPLAMGLFTESGPPQWHPAPEEIKEACAKA 232
gi 302794446 153 PLAIFRYVLDRVEPGTIDVILSYCHYSLNDSSLEGLIPYLKDKGVGIITASPLAMGLLTESGPPQWHPAPEEIKEACAKA 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 168013997 241 AKACKEQGKSIAKLAVQYALRNRNLITTLIGMPSVAEVRENVRIAIEAEhgTLDID-EELLQQVEQILQPVKNKTWPSGL 319
gi 15235040  240 VAHCKSKGKKITKLALQYSLANKEISSVLVGMSSVSQVEENVAAVTELE--SLGMD-QETLSEVEAILEPVKNLTWPSGI 316
gi 168048191 240 TEVCKAQGKSIAKFALQYALRERRIATTLVGMSSVDLVRENVKTAIEVEqsIASID-EELLQQLEQILQPVKNMTWPSGR 318
gi 225429064 240 AAHCKEKGKNISKLAMQFSLSNKDISSVLVGMNSIKQVEENVAAATELA--IFGKD-EETLSEVEAILNPVKNQTWPSGI 316
gi 224056323 245 AAFCKAKGKNISKLAMQYSLANKDISSVLVGMNSVRQVKENVYAATELA--TFGKD-QETLSEVEAILSPVKNQTWPSGI 321
gi 224103819 244 AAFCKEKGKNISKIAMQYSLSNKDISSVLVGMNSVRQVEENVSAATELA--TFGKD-QETLSEVEAILIPVKNQTWPSGI 320
gi 255554531 244 AAHCKEKGKNISKLAMQYSLWNKDIASVLVGMNSVSQVQENVAAATELA--TFGKD-QETLPEIEAILSPVKNQTWPSGI 320
gi 297798560 240 VTHCKSKGKKITKLALQYSLANKEISSVLVGMSSVSQVEENVAAVTDLE--SLGMD-QETMSEVEAILGPVKNLTWPSGI 316
gi 302809502 233 ATHCKLKGQNISEIALKFSLSNPDIAITLVGMCTTQQVHENIKAMDNLE--RSSVDcENILDEVKEILAPIKNKTWPCGR 310
gi 302794446 233 ATHCKLKGQNISEMALKFSLSNPDIAITLVGMCTTQQVHENIKAMDNLE--RSSVDcENILDEVKEILAPIKNKTWPCGR 310

                 ...
gi 168013997 320 LEN 322
gi 15235040  317 HQN 319
gi 168048191 319 EEN 321
gi 225429064 317 QQS 319
gi 224056323 322 QES 324
gi 224103819 321 QQS 323
gi 255554531 321 QQS 323
gi 297798560 317 HQN 319
gi 302809502 311 PEN 313
gi 302794446 311 PEN 313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap