Conserved Protein Domain Family
PLN02407

?
PLN02407: PLN02407 
diphosphomevalonate decarboxylase
Statistics
?
PSSM-Id: 178029
View PSSM: PLN02407
Aligned: 15 rows
Threshold Bit Score: 559.024
Threshold Setting Gi: 219114256
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
223994695   1 IHTATVSAPTNIACIKYWGKASSKYNTPINSSLSLTLDQSDLRAVTTAAASTSFTKDRLWLNGSEEanAFTSKRFRACID 80 
168042855   9 VVMKTARAPSNIAVIKYWGKRDEKLILPINSSISVTLDPEHLSATTTVAASPAFEKDRLWLNGKEV--SVEGVRYKNCLR 86 
168044045  10 VVMKTARAPSNIAVIKYWGKRDEKLILPINSSISVTLDPEHLSATTTVAASPAFERDRLWLNGKEV--SVEGERYRNCLR 87 
18410026    7 VFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRDRMWLNGKEI--SLSGSRYQNCLR 84 
224110186   7 VRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSFDQDRMWLNGKEI--SLSGGRYQNCLR 84 
224097622   7 VRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSFDQDRMWLNGKEI--SLSGGRYQNCLR 84 
242063382   9 LLMATGRTPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNGKEI--SLLGGRFQSCLR 86 
255560311   6 VRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGKEI--SLSGGRYQNCLR 83 
302821362   9 IVSRTARAPSNIAVIKYWGKRDEDLILPLNSSISVTLDPNDLSATTTVSTSPDFDADRLWLNDKEV--SLSSHRYVSCLK 86 
302795167   9 IVSRTARAPSNIAVIKYWGKRDEDLILPLNSSISVTLDPNDLSATTTVSTSPDFDADRLWLNDKEV--SLSSHRYVSCLK 86 
223994695  81 GLRALAtDKVDPTTNEVIVSKSQWQSMHVHVASYNTFPTAAGLASSAAGYAALVASLVELYNAKESYPGEFTAIARQGSG 160
168042855  87 EMRARA-TDVVIESSGKVIRKEDWNSLHIHIASENNFPTAAGLASSAAGFACLVYALAQLMGVQEKYEGELTAIARLGSG 165
168044045  88 EMRARA-TDVVIESSGKVITKEVWSTLHIHIASENNFPTAAGLASSAAGFACLVYSLAQLMNVKEKYEGELTAIARLGSG 166
18410026   85 EIRGRA-GDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTAAGLASSAAGFACLVFSLAKLMNVDED-PSHLSAIARQGSG 162
224110186  85 EIRAQA-CDAEDEEKGIKITKKDWEKLHVHVASYNNFPTAAGLASSAAGFACLVFALAKLMNAKED-NSELSAIARQGSG 162
224097622  85 EIRARA-CAVEDKEKGIKIAKKDWEKLHLHVASYNNFPTAAGLASSAAGFACLVFALAKLMNAKED-NSELSAIARQGSG 162
242063382  87 EIRKRA-RDFEDEEKGVKIKKEDWGKLHVHIASYNNFPTAAGLASSAAGLACFVFTLGKLMNVKED-YGELSSIARQGSG 164
255560311  84 EIRARA-CDVEDKEKGIKIAKKDWEKLHVHIASFNNFPTAAGLASSAAGFACLVFALAKLMNARED-NSELSAIARQGSG 161
302821362  87 ELRDRA-TDVKDEKTGIVITKEDWKHLKLHIVSKNNFPTAAGLASSAAGFACLVFTVAELMGIKESFPGELSTIARRGSG 165
302795167  87 ELRDRA-TDVKDEKTGIVITKEDWKHLKLHIVSKNNFPTAAGLASSAAGFACLVFTVAQLMGIKESFPGELSTIARRGSG 165
223994695 161 SACRSLYGGFVAWRAGGMKEDwSDSIAEQVADEMHWKEMRAVILVVSDAKKETSSTVGMETSVATSELLAHRAKEIVPKR 240
168042855 166 SACRSLYGGFVEWKMGQEIDG-TDSIAVQLAEESHWKDLVIIIAVVSSRQKETSSTSGMQESVKTSPLLKYRAEEVVPKR 244
168044045 167 SACRSLYGGFVKWNMGKEADG-KDSIATQLAEQSHWEDLVIIIAVVSSRQKETSSTSGMQESVKTSPLLKYRAEEMVPKR 245
18410026  163 SACRSLFGGFVKWTMGSKEDG-SDSVAVQLADEKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPKR 241
224110186 163 SACRSLFGGFVKWIMGKAEDG-SDSLAVQLVDEKHWDELVIIIAVVSSRQKETSSTTGMRDSVETSLLLQHRAKEVVPKR 241
224097622 163 SACRSLFGGFVKWIMGKAEDG-SDSLAVQLVDEKHWDELVIIIAVVSSRQKETSSTTGMRDSVETSLLLQHRAKEVVPKR 241
242063382 165 SACRSIYGGFVKWCMGEKDDG-SDSIAVQLADETHWNDLVIIIAVVSSKQKETSSTSGMRDSVETSPLLQYRAQTVVPSR 243
255560311 162 SACRSLFGGFVKWIMGKVDDG-SDSLAVQLVDEKHWDDLVIIIAVVSSRQKETSSTSGMRESVETSLLLQHRAKEVVPKR 240
302821362 166 SACRSLHGGFVKWEMGKRADG-KDSIAVPLAEHHEWDDLRIVICVVSSRQKEVSSTSGMQESVQTSPLLHYRAKEVVPKR 244
302795167 166 SACRSLHGGFVKWEMGKRDDG-KDSIAVPLAEHHEWDDLRIVICVVSSRQKEVSSTSGMQESVQTSPLLHYRAKEVVPKR 244
223994695 241 MKIIEDAIQAKDFEAFGKVTMMDSNQFHATCLDTYPPIFYMNDVSRSVIQMVTRYNEWAGEIRAAYTFDAGPNAVLYTLD 320
168042855 245 IVQMEKAIKSMNFTEFAKITCADSNQFHATCLDTSPPIFYLNDTSRKLIGLVERWNRHAGEPQVAYTFDAGPNAVMFAKN 324
168044045 246 IGQMEKAIKSMDFAEFARITCADSNQFHATCLDTSPPIFYLNDSSRRLIGLVERWNRHAGEPQVAYTFDAGPNAVMFAKN 325
18410026  242 ILQMEEAIKNRDFASFTQLTCTDSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARN 321
224110186 242 IKQMEEAIKNRDFGSFAQLTCADSNQFHAVCLDTCPPIFYMNDTSHRIISCVEKWNRSEETPQVAYTFDAGPNAVLIAHN 321
224097622 242 IKQMEEAIKNRDFGSFAQLSCADSNQFHAVCLDTCPPIFYMNDTSHRIISCVEKWNCSEGTPQVAYTFDAGPNAVLIAHN 321
242063382 244 VLKMEEAIKNRDFESFAKLTCADSNQFHAVCLDTSPPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPNAVLIAQN 323
255560311 241 IIQMEEAINKRDFASFAQITCADSNQFHAVCLDTCPPIFYMNDTSHRIISCVEKWNRSEETPQVAYTFDAGPNAVLIAQN 320
302821362 245 ITEMEEALSKRDFSSFAKLTCADSNQFHATCLDTSPPIFYMNDTSRRIIGLVERWNKSEGSPQAAYTFDAGPNAVIFVPQ 324
302795167 245 ITEMEEALSKRDFSSFAKLTCADSNQFHATCLDTSPPIFYMNDTSRRIIGLVERWNKSEGSPQAAYTFDAGPNAVIFVPQ 324
223994695 321 KYVVe-LLALVLKHYPAQSPELLGEYV 346
168042855 325 KEVAaqLLQRLLYQFPPSADTDISRYV 351
168044045 326 KEVAvqLLKRLLYQFPPSAEADLSRYV 352
18410026  322 RKVAvqLLQGLLYYFPPKSDTDMKSYV 348
224110186 322 RKAAtqLLQKLLFYFPPSSDADLNSYV 348
224097622 322 RKAAtqLMQKLLFCFPPSSDADLNSYV 348
242063382 324 RKTAahLLQKLLYYFPPQ-DKDLSSYL 349
255560311 321 RKTAvqLLQKLLYYFPPNSDTDLNSYV 347
302821362 325 KSGGa-LLHRLLYEFPPPEGMNLSSYV 350
302795167 325 KSGGa-LLHRLLYEFPPPEGMNLSSYV 350
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap