Conserved Protein Domain Family
PLN02326

?
PLN02326: PLN02326 (this model, PSSM-Id:177960 is obsolete and has been replaced by 215185)
3-oxoacyl-[acyl-carrier-protein] synthase III
Statistics
?
PSSM-Id: 177960
View PSSM: PLN02326
Aligned: 18 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255085230  50 AFTPAGAKIAGVGMAVPTQYLTNDDLSELVDTNDEWIRTRTGIGKRHVISGDESLTSLAAEASKKALTAAGVAPEDLDLI 129
168034759   1 RRVGRGSRLVGSGSAVPKHVISNEELSKFVDTSDEWISLRTGIRNRQ----DESLTTLSVDASRKALEMANVKPEEVDLL 76 
168002625   1 RRVGRGSRLVGSGSAVPKHLITNEDLSKFVDTSDEWISVRTGIRNRRVVHGLESVTSLSVEASRKALEMANVKPEDVDLL 80 
159490266   1 -------QLVGVGSSVPETFLTNDDLAKLVDTNDEWIVTRTGIKKRHVLGKGETLVQHAVISSKRALEMAGVDAKDVDLV 73 
145354437  42 AFDVAGAKISGVGKAIPEKFLTNDDLSELVETNDEWIATRTGIRKRHVITGDETLTSLGAHAAKQALERANVKAEDLDLI 121
115460900  72 RVVGMGSKLIGCGSATPSLSVSNDDLSKIVETSDEWIAARTGIRNRRVLSGNETLRELSVQAAKKALEMAQVNADDVDLV 151
242077378  65 RVVGMGSKLVGCGSAIPTLSVSNDDLSKIVETSDEWIAARTGIRNRRVLSGDETLRGLSIQAAQRALEMAEVKAEDVDLV 144
302808927  59 RRVGSGTKLIGCGSAVPKQVIHNDDLSKFLDTSNEWILPRTGIEQRRVLSGEETLKGLAVDACKRALEMAKVEPEDLDLI 138
302806443  59 RRVGSGTKLIGCGSAVPKQVIHNDDLSKFLDTSNEWILPRTGIEQRRVLSGEETLKGLAVDACKRALEMAKVEPEDLDLI 138
302838895   1 -------MLVGVGSSVPETYLTNHDLEKLVETSDDWIVTRTGIKKRHVLGKGETLAQHGIASAKRALEMAGIAAQDVDLV 73 
255085230 130 LLSTSSPDDLFGSACTVQAAIGATGALAVDLTAACSGFVVGVVNGVHFIRGGEYKNVLVIGADVLSRYVDWRDRGTCILF 209
168034759  77 LLCTSTPDDLFGSAPQVQKLLGCHNALAFDLTAACSGFVLGLVTATRFIRGGGYKNVLVVGADALSRYVDWTDRGTCILF 156
168002625  81 LLCTSTPDDLFGSAPQVQKLLGCHNALAFDLTAACSGFVLGLVTATRFIRGGGYENVLVVGSDALSRYVDWTDRGTCILF 160
159490266  74 LFATSSPDDVFGSACQVQAAVGASKAVAFDLTAACSGFVLAMVTASQYIRAGTFKTVLVVGGDALSRFVDWRDRGTCILF 153
145354437 122 ILATSSPDDIFGSACTIQAAIGAKNALAFDLTAACSGFVIGLVNGAQFIRAGGYKNVLVIGGDVLSRYVDWRDRGTCILF 201
115460900 152 LLCTSTPDDLFGGAAQVLAEVGCANAFGFDITAACSGFIIGLITATRFIKGGGIRNILVIGADALSQFVDWTDRGTCILF 231
242077378 145 LLCTSTPDDLFGGAAQVLAEVGCTNAFGFDITAACSGFIVGLITATRFIKGGGLQNVLVVGADALSKYVDWTDRGTCILF 224
302808927 139 LFCTSSAEDTFGGAPEIQRELSCSNALAFDLTAACSGFVVGLVTATRYIKGGGYKTALVVGADALSRYVDWSDRSTCILF 218
302806443 139 LFCTSSAEDTFGGAPEIQRELSCSNALAFDLTAACSGFVVGLVTATRYIKGGGYKTALVVGADALSRYVDWSDRSTCILF 218
302838895  74 LFATSSPDDVFGSACQVQASIGARHAVAFDLTAACSGFVVALVTAAQYIRAGTFRTVLVVGGDALSRFVDWRDRGTCILF 153
255085230 210 GDGCGAMVLTSTPDPSDc-CLLGFDMHSDGTGNHNLTAQFAYEagtDTAGKSKPTAEGGDAPSSRGAFCNIGMNGQEVFK 288
168034759 157 GDASGALLLQAATDDQD--SLLGFDLRSDGNGHKHLHVTVDDV---DSSPNGAETNGSTFKLPGKATYECLQMNGKEVFK 231
168002625 161 GDASGALLLQAATDDQD--SLLGFDLRSDGNGHKHLHVTVDSVa--ESSSSGAETNGAAFLQPGKASYECLQMNGKEVFK 236
159490266 154 GDGCGAVLMRANPDPAAppAILGMDMGSDGAGHKHLHCMFSGA----GTAGGGAPHGEGEGPSSHASYANIHMAGQDVFK 229
145354437 202 GDGAGAAVLTATDAANC--SLKGFDMHSDGSQNHHLVAQYIGD----------NGKPMSDGASKTAAFCNISMSGQDVFK 269
115460900 232 GDAAGAVLVQACSADED--GLLGFCVQSDGNGQKHLNCVSSHV-----ESILSKTNGVPSFPPKKATFSNIEMNGKEVFR 304
242077378 225 GDAAGAVLVQACNADED--GLLGFCVQSDGNGQKHLNATTAND-----ESILSNTNGVPGFPPKKATYSCIQMNGKEVFR 297
302808927 219 GDGAGAVVLQACSEDED--SLLGFDMHTDGSGQKHLHARIEPAe-dAKILHNGNGSTTISTPARPPSYQCVQMNGREVFR 295
302806443 219 GDGAGAVVLQACSEDED--SLLGFDMHTDGSGQKHLHARIEPAe-dAKILHNGNGSTTISTPARPPSYQCVQMNGREVFR 295
302838895 154 GDGCGAVVVTANPDPEApgAILGMEMGSDGGGHKHLHCTFAGS--------GMKPLSDGADPSSHAAYSNIYMAGQDVFK 225
255085230 289 FAVKTVPDTVSKSLEKAGMT--SEDIDFLVMHQANQRIIDTAAKRFGLGPEKVVSNIAKYGNTSAGSVPIAMAEAVEEGR 366
168034759 232 FAVRAVPQVVEGALQEAGLT--GDNVDWLLLHQANQRILDSVSDRLHIPSEKVISNLANYGNTSAASIPLALDEAVRSGK 309
168002625 237 FAVRAVPQVVEGALQEAGIT--GNDVDWLLLHQANQRILDSVSDRLHIPSEKVISNLANYGNTSAASIPLALDEAVRSGK 314
159490266 230 FAVRTVPAVIDSALANANLP--KESVDWLVMHQANQRILDAAAQCSCSPPIAWVSS----SRIGVASRPLGEGERVR-GR 302
145354437 270 FAVRTVPMTVNKSLAAASMT--AEDIDKLVLHQANQRIIDSAAQRFGLSEDKVVSNIAEYGNTSAGSVPIALCEAVESGA 347
115460900 305 FAVRCVPQSIEKALEEAGLP--ASSIDWLLLHQANQRIIDAAASRLDIPSDKVISNLANYGNTSAASIPLALDEAVRAGK 382
242077378 298 FAVRCVPQSIEKALQEAGLP--ASSIDWLLLHQANQRIIDAAASRLDIPSDKVISNLANYGNTSAASIPLALDEAVRSGK 375
302808927 296 FAVRSVPQVVEAALQEAGLE--NHHIDWLLLHQANQRIIDAVSERLAISQERVLSNLVNYGNTSAASIPLALDEAVRSGK 373
302806443 296 FAVRSVPQVVEAALQEAGLE--NHHIDWLLLHQANQRIIDAVSERLAISQERVLSNLVNYGNTSAASIPLALDEAVRSGK 373
302838895 226 FAVRTVPAVIDGALAKANLPkaSESVDWLVMHQANQRILDAAAQRLGLPAERVVSNLSQYGNTSAASIPLALDEAVRGGR 305
255085230 367 IKKGD------------IVATAGFGAGLTWASAILRW 391
168034759 310 VKAGD------------VVATAGFGAGLTWGSAIVRW 334
168002625 315 VKAGD------------VVATAGFGAGLTWGSAIVKW 339
159490266 303 KGAG-------------ILAMAGFGAGLTWAGAIVRW 326
145354437 348 IKEDD------------IIAFAGFGAGLTWASAIWKF 372
115460900 383 VKAGD------------VIAASGFGAGLTWGSAIVKW 407
242077378 376 VKNGD------------IIAASGFGAGLTWGSAIVKW 400
302808927 374 VKRGD------------VIASAGFGAGLTWASAIFKW 398
302806443 374 VKRGD------------VIASAGFGAGLTWASAIFKW 398
302838895 306 IQKGDkassewgigqgkVIAMAGFGAGLTWAGAIVRW 342
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap