Conserved Protein Domain Family
PLN02283

?
PLN02283: PLN02283 
alpha-dioxygenase
Statistics
?
PSSM-Id: 177921
View PSSM: PLN02283
Aligned: 14 rows
Threshold Bit Score: 1014.69
Threshold Setting Gi: 302753830
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PLN02283 is a member of the superfamily cl14561.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15232116    6 SLISSILLKFIHKDFHEIYARMSLLDRFLLLIVHGVDKMVPWHKLPVFLGLTYLEVRRHLHQQYNLLNVGQTpTGIRFDP 85
gi 15219521    1 MGFSPSSSWFLHPQLHHVVSKMSYFDAFLFYIVHLVDKLGLWHRFPVLLGVAYLGLRRHLHQRYNLVHVGPI-NGQGYDT 79
gi 115488462   1 -MGSGLFKPRVHPDLRDVFSKMSFFDKIGFLFIHAFDKRNLWHKVPVPIGLLYLNTRRTLLEKYNLLAVGRSsHGALFDP 79
gi 225456100   1 MAFSKSSSSFIHPQLLHIVAKMTLFDTFLFYIVHFVDKLGVWHRLPVLLGLAYLGIRRHLHQRYNLLHVGGV-NGGRYDT 79
gi 225452530  10 SLLTAPLHHFIHEDFHEVVARMTLIDRFLFLIIHSIDKLGIWHRLPVFLGLIYLAIRRHLHEQYNLFNVGSTpRGVRYNP 89
gi 225452532   6 TLLSAPLLYFIHKDFHGALANMTLIDRFLFLIIHSIDKLGIWYRLPVFLGLVYLLIRRHLHNQYNLFNVGPTpVGVRFNP 85
gi 224099169  10 KLSSASLRRFIHQDFHEVVDRMTIIDAFLFLIVHSIDKLGIWHRLPVFLGLLYLSVRRHLHQEYSLFNVGRSpTGVRYNP 89
gi 224121214   1 MAFSLSSSSFIHPQLRHIVYKMNLFDTLLFFVIHFVDKLGLWHRLPVLLGLAYMAIRRHLHQRYNLLHVGGI-NGQKYET 79
gi 255577350   1 MGFSLLSSPFVHPQLSEIVSKMTLFDTIFFYAIHFVDKMELWHRLPVILGIIYLAIRRHLHQRYNLLNVGGI-NGQKYDT 79
gi 297842117   1 MGFSPSSSWFLHPQLHHVVSEMSYFDAFIFYIVHLVDKLGLWHRFPVLLGVAYLGLRRHLHQRYNLVHVGPI-NGQGYDN 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15232116   86 ANYPYRTADGKFNDPFNEGVGSQNSFFGRNCPPVDQKSKLRRPDPMVVATKLLGRKKFIDTGKQFNMIAASWIQFMIHDW 165
gi 15219521   80 DEFCYRTADGKCNHPSDNTIGSQGSFIGRNMPPSTSQYGILDPHPSVVATKLLARKRFIDNGDQFNVIACSWIQFMIHDW 159
gi 115488462  80 KEFLYRTEDGKYNDPHNAEAGSQNTFFGRNMEPVDQQDELMSPDPFVVATKLLARREYKDTGKQFNILAAAWIQFMVHDW 159
gi 225456100  80 EEFCYRTADGKCNHPIDDQIGSQGTLFGRNMPPSTSSYRLLEPHPTVVATKLLARKKFIDNGKQFNLIACSWVQFMIHDW 159
gi 225452530  90 VDYPYRTADGEYNDPFNEGAGSQGTFFGRNILPVDQKDKLKKPDPMVVATKLLARKDFTDTGKQFNMIAASWIQFMIHDW 169
gi 225452532  86 ADYPYRTADGEYNDPFNDDAGSQGTFFGRNILPVDQKDKLKKPDPTVVATKLMARRNFTDTGKQFNMIAASWIQFMIHDW 165
gi 224099169  90 ADYPYRTADGKYNEPFNEGAGSQGTFFGRNVLPVNQQDKLKKPDPMVVATRLLARKKFIDTGKQFNMIAASWIQFMIHDW 169
gi 224121214  80 EEFSYRTADGKCNHPSDDIIGSQGTFFGRNMLPANSRYGLLDPHPTVVANKLLARNKFIDNGKQFNMIACSWIQFMIHDW 159
gi 255577350  80 NEFSHRTADGKCNHPSDHIIGSQGTFFGRNMPPSSSPYWLLDPHPTVVANKLLARKKFIDNGKQFNMIACSWIQFMIHDW 159
gi 297842117  80 DEFCYRTADGKCNHPSDDSIGSQGSFIGRNMPPSTSQYGILDPHPSVVATKLLARKRFIDNGDQFNVIACSWIQFMIHDW 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15232116  166 IDHLEDTHQIELVAPKEVASKCPLSSFRFLKTKEVPTGFFEiKTGSQNIRTPWWDSSVIYGSNSKTLDRVRTYKDGKLKI 245
gi 15219521  160 VDHLEDTHQIELEAPEEVASGCPLKSFKFLRTKKVPTDDHH-KSGAVNTRTPWWDGSVIYGNDETGMRRVRVFKDGKLKI 238
gi 115488462 160 MDHMEDTGQIGITAPKEVANECPLKSFKFHPTKELPTNSDGiKIGHYNIRTAWWDGSAVYGNNEERAEKLRTYVDGKLVI 239
gi 225456100 160 IDHMEDTQQIEIKAPSDIASGCPLKSFKFFKSKSIPTGSPHmEDGFLNTRTPWWDGSVIYGNNDDGMRRVRTFKDGKLKI 239
gi 225452530 170 IDHMEDTQQIELTAPREVASQCPLKSFKFYKTKEVATGFYDiKSGSLNIRTPWWDGSAIYGSNEKQLQRVRTFKDGKLKI 249
gi 225452532 166 TDHLEDTQQIELTAPREVASQCPLKSFKFYKTKEVPTGFYDiKTGSLNIRTPWWDGSAIYGNNAKKLQKVRTFKDGKLKI 245
gi 224099169 170 VDHMEETAQIELVAPKEVANQCPLKSFRFYKTKEVPTGFWDiKSGALNIRTPWWDGSAIYGSNEKRLHKVRTFKDGKLKI 249
gi 224121214 160 IDHMEDTQQVELKAPDKIADGCPLKSFKFYKTKKVSTGSPYmKTGSLNTRTPWWDGSVIYGNNEDGMRKVREFKDGRLRI 239
gi 255577350 160 IDHMEDTQQVEIRAPDEIADGCPLKSFKFYKTKKVHTGSPDfRTGCVNTRTPWWDGSVIYGNNEDGMRRVRTFRDGKLKI 239
gi 297842117 160 VDHLEDTHQIELEAPEEVASGCPLKSFKFLRTKKVPTGDHH-KSGAVNTRTPWWDGSVIYGNDEAGMRRVRVFKDGKLKI 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15232116  246 SEEtGLLLHDEDGLAISGDIRNSWAGVSALQALFIKEHNAVCDALKDEDDDLEDEDLYRYARLVTSAVVAKIHTIDWTVQ 325
gi 15219521  239 SGD-GLLERDERGVPISGDIRNSWSGFSLLQALFVKEHNSVCDMLKERYPDFDDEKLYRTARLVTAAVIAKVHTIDWTIE 317
gi 115488462 240 GDD-GLLLHKENGVALSGDIRNSWAGVSILQALFVKEHNAVCDAIKEEHPNLSDEELYRYAKLVTSAVIAKVHTIDWTVE 318
gi 225456100 240 SND-GLLEHDGKGIPISGDVRNCWAGFSLLQALFVKEHNAVCDMLKVHHPEFDDERLYRHARLVTSAVIAKIHTIDWTVE 318
gi 225452530 250 SED-GLLLHDQDMIPVSGDVRNSWAGVSTLQALFVKEHNAVCDALKKEYRHMNDEELYHRARLVTSAVIAKIHTIDWTVE 328
gi 225452532 246 SED-GFLLHDQDMIPLSGDVRNGWAGLSTLQALFIKEHNAVCDALKKENGHLSDEELYRHARLVTSAVIAKVLTIDWTVE 324
gi 224099169 250 SED-GLLLHDQDGIAVSGDVRNSWAGVSILQALFVKEHNAVCDTLKREYKDLGDEELYRHARLVTSAVIAKVHTIDWTVE 328
gi 224121214 240 AGD-GLLEHDEKGIPISGDVRNCWAGFSLLQALFVKEHNA------ENYPDFDDEKLYRHARLVTSAVLAKIHTIDWTVE 312
gi 255577350 240 AED-GLLEHDEKGIPISGDVRNCWAGFSLLQALFVKEHNAVCDMLREHYPDSDDDKLYQHARLVTSAVIAKIHTIDWTVE 318
gi 297842117 239 SGD-GLLERDERGVPISGDIRNSWSGFSLLQALFVKEHNSICDMLKERYPDFDDEKLYRTARLVTAAVIAKVHTIDWTIE 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15232116  326 LLKTDTLLAGMRANWYGLLGKKFKDSFGHAGSSILGGVVGMKKPQNHGVPYSLTEDFTSVYRMHSLLPDQLHILDIDD-- 403
gi 15219521  318 LLKTDTLTAGMRINWYGFFGKKVKDMVGARFGPLFSGLVGLKKPNDHGVPYSLTEEFVSVYRMHCLLPETLILRDMNS-- 395
gi 115488462 319 LLKTKTMRAAMRANWYGLLGKKIKDTFGHIGGPILGGLVGLKKPNNHGVPYSLTEEFTSVYRMHSLIPSTLKLRDPTG-- 396
gi 225456100 319 LLKTDTLLAGMRINWYGFMGKKFKDSFGHILGPILSGLVGLKKPRDHGVPYSLTEEFVSVYRMHALLPDELHIRDTNSsn 398
gi 225452530 329 LLKTDTLLAGMRANWYGLLGKKFKDTFGHVGGTILGGLVGQKKPNNHGVPYSLTEEFTTVYRMHELLPDHLLLRDISA-- 406
gi 225452532 325 LLKTDTLHAAMRGNWSGLLGKKFKDTYGHVGGAILGGLVGLKRPNNHGMPHSLTEEFVSVYRMHQLLPDHLLLRDISA-- 402
gi 224099169 329 LLKTDTLLAGMRGNWYGLLGKNFKDKFGHVGGAILGGVVGLKKPENHGVPYSLTEEFVSVYRMHSLLPDHLQLRDISA-- 406
gi 224121214 313 LLRTDTLLAGMRINWYGFLGKKIKDLFGHFGGPVLSGLVGLRRPRDHGVPYSLTEEFVSVYRMHSLLPEKLILRDIHS-- 390
gi 255577350 319 LLKTNTLLAGMRINWYGFFGKKVKDLFGHFAGPLFSGLVGLRKPRDHGVPYSLTEEFTSVYRMHSLLPDQLIIRDIRS-- 396
gi 297842117 318 LLKTDTLTAGMRINWYGFLGKKVKDMVGARFGPIFSGLVGLKKPKDHGVPYSLTEEFVSVYRMHCLLPETLILRDMKS-- 395
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15232116  404 VPGTNKSLPLIQEISMRDLIGRKGEETMSHIGFTKLMVSMGHQASGALELMNYPMWLRDIVPHDPNGQARPDHVDLAALE 483
gi 15219521  396 ENVDKENPAIEREIPMTELIGKKAGEKASKLGFEQLLVSMGHQSCGALTLWNYPNWMRNLVAQDIDGEDRPHLIDMAALE 475
gi 115488462 397 QPDANNSPPCLEDIDIGEMIGLKGEEQLSKIGFEKQALSMGYQACGALELWNYPSFFRNLIPQNLDGTNRSDRIDLAALE 476
gi 225456100 399 TASEGECPPLIEEVPMREMVGLEGEKRLSKIGMEKMMVSMGHQASGAMALWNYPSWMRNLVAHDVNGEDRPDLVDMAALE 478
gi 225452530 407 APGLNKSPPLVKKLSMPNLIGHEGERALSEIGFARQMVSMGHQASGALQLWNYPVWLRDLIPQDVDGKDRSDHVDLPALE 486
gi 225452532 403 SPGPNKSPPLIKKVPMQNLIGHQGEKALSEIGFTEQMVSMGHQACGALELWNYPVWLRDLIPQDVDGRNRPDPVDLPSLE 482
gi 224099169 407 APDSHKSPPSTDKIPMPSLIGLVGEKTLSGIGFIKLMVSMGHQASGALEPWNYPMWLRDVVAQEVDGTDRPDHVDLAALE 486
gi 224121214 391 TASEYECPPVVEEVPMREMAGKDGERRLSELGMEQMLVSMGHQACGAVKLWNYPSWMRNLVAHDINGEDRPDQVDMAAME 470
gi 255577350 397 TTSESGCPPVLEEVPMKEMAGKEGEKKMSEIGMELMLVSMGHQACGAVTLWNYPSWMRNLVAHDINGEDRPDPVDMAAIE 476
gi 297842117 396 ENVDKANPAIEREIPMTELIGKEAGLKGSKIGFEQLLVSMGHQSCGALTLWNYPNWMRNLVAQDIDGEDRPHLIDMAALE 475
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15232116  484 IYRDRERSVPRYNEFRRSMFMIPITKWEDLTEDEEAIEVLDDVYDGDVEELDLLVGLMAEKKIKGFAISETAFYIFLIMA 563
gi 15219521  476 IYRDRERGVPRYNEFRKNLLMSPISKWEELTDDEEAIKVLREVYEDDIEKLDLNVGLHAEKKIKGFAISETAFFIFLLVA 555
gi 115488462 477 VYRDRERSVPRYNEFRRRLFLIPIKSWEDLTSDKDAIETIRAIYGDDVEKLDLLVGLMAEKKIKGFAISETAFNIFILMA 556
gi 225456100 479 IYRDRERGVARYNEFRRNLLMIPISKWEDLTDDEKVVEALCEVYGDDVEKLDLLVGLHAEKKIKGFAICETAFFIFLLIA 558
gi 225452530 487 IYRDRERKVARYNQFRRALLLIPISKWEDLTDDSETIKILRELYGDDVEELDTHVGLMAEKKIKGFAISETAFVIFIVMA 566
gi 225452532 483 IYRDRERKVASYNQFRRALLLIPISKWEDLTDDTETIRSLRELYGDNVEELDTQVGLMAEKKIKGFAISETAFVIFIINA 562
gi 224099169 487 VYRDRERNVARYNEFRRALLLIPISKWEDVTDDQEVIEALHQVYGDEVEELDLLVGLMAEKKIKGFAISETAFIIFLIMA 566
gi 224121214 471 -SKDRERGVARYNEFRRNLLMIPISNWEDLTDDEEVIEALRDVYGNDVEKLDLLIGLHAEKKIKGFAISETAFFIFLLIA 549
gi 255577350 477 IYRDRERGVARYNEFRRNLLMIPIRKWEDLTDEQEVVEALHEVYGDDVEKLDLLIGLHAEKKMKGFAISETAFFIFLLIA 556
gi 297842117 476 IYRDRERGVPRYNEFRKNLLMSPISKWEELTDDEEAIKVLREVYEDDIEKLDLNVGLHAEKKIKGFAISETAFFIFLLVA 555
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 15232116  564 TRRLEADRFFTSDFNETIYTKKGLEWVNTTESLKDVIDRHYPDMTDKWMNSESAFSVWDSPPLTKNPIPLYLRIPS 639
gi 15219521  556 SRRLEADRFFTTNFNEKTYTKEGLEWVNTTETLKDVIDRHFPRLTDQWMRCSSAFSVWGSDPNPKNWVPLYLRSAP 631
gi 115488462 557 SRRLEADRFFTSNFNEETYTKKGMQWVKTTEGLRDVINRHYPEITAKWMKSSSAFSVWDADY-------------- 618
gi 225456100 559 SRRLEADRFFTTNFNSQTYTRSGLDWVNKTETLQDVLDRHFPDMTKKWMRCSSAFSVWDSTPTPTNYIPLYLRPAP 634
gi 225452530 567 SRRLGADRFFTSNFNEETYTKKGLEWVNTTESLKDVLDRHYPEMTEKWMNSSSAFSVWDSAPNAHNLVPLYLRVPH 642
gi 225452532 563 SRRLEADRFFTSNFNEETYTKKGLEWVNTTESLKDVIHRHYPEMTDKWMNSSSAFSVWDSPPNPHNLVPLYLRVPH 638
gi 224099169 567 TRRLEADRFFTSNFNEETYTKKGFEWVNSTESLKDVLDRHYPEMTAKWMNSASAFSVWDSPPPSPNPIPLLFRVPK 642
gi 224121214 550 SRRLEADRFFTTNFNSRTYTEKGLEWVNKTETLKDVIDRHFPGMTKKWMKCTSAFSVWDSEPNQTTYIPLYLRPAP 625
gi 255577350 557 SRRLEADRFFTTNFNSKSYTEKGLEWVNKTETLKDVIDRHFPGMTKKWMRCSSAFSVWDSEPDQMSYVPLYLRPAA 632
gi 297842117 556 SRRLEADRFFTTNFNEKTYTKEGLEWVNTTETLKDVIDRHFPSLTDQWMRCSSAFSVWGSDPNPNTWVPLYLRSAP 631
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap