Conserved Protein Domain Family
PLN02235

?
PLN02235: PLN02235 
ATP citrate (pro-S)-lyase
Statistics
?
PSSM-Id: 177879
View PSSM: PLN02235
Aligned: 25 rows
Threshold Bit Score: 775.098
Threshold Setting Gi: 159485736
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 302849248   1 MARKKIREYDAKRLLKAHIKRLAGLDLPIQVVQFTAASNPSDLLNENPWLGNTRLVVKPDMLFGQRGKNDLVGLNLDFSQ 80
gi 168022395   1 MARKKIREYNSKRIFKEHLKRLAGIDVDIKAAQVTQSTDFNELANKEAWLNSTRLVVKPDMLFGKRGKSGLVALNLDLAG 80
gi 168000813   1 MARKKIREYDSKRILKEHLKKLAGIDIAIKSAQVTESTDFTKLAEQEPWLNSTRLVVKPDMLFGKRGKSGLVALNLDLAG 80
gi 15217510    1 MARKKIREYDSKRLLKEHLKRLANIDLQIRSAQVTESTDFTELTNQESWLSSTKLVVKPDMLFGKRGKSGLVALKLDLAE 80
gi 224124562   1 MARKKIREYDSKRLLKEHLKRLSGIDLQICSAQVTEGTDFTELTNKEPWLSSTKLVVKPDMLFGKRGKSGLVALNLDLAQ 80
gi 224124954   1 MARKKIREYDSKRLLKEHLKRLSGIDLLIRSAQVTEGTDFTELTNQEPWISSTKLVVKPDMLFGKRGKSGLVALNLDLAQ 80
gi 225450474   1 MARKKIREYDSKRLLKDHLKRLAGIDLQICSAQVTEATDFAELTNKEPWLSSTRLVVKPDMLFGKRGKSGLVALNLDLAQ 80
gi 255543008   1 MARKKIREYDSKRLLKEHLKRLAGLDIQICSAQVTESTDFTELTNQEPWLSSSRLVVKPDMLFGKRGKSGLVALNLDLAQ 80
gi 297843736   1 MARKKIREYDSKRLLKEHLKRLANIDLQIRSAQVTESTDFTELTNQESWLSSTKLVVKPDMLFGKRGKSGLVALKLDLAE 80
gi 302775344   1 MARKKIREYDSKRLLKQHLKRLASIDLALHSAQVTQETDFDALADKEPWLNSTRLVVKPDMLFGKRGKSGLVALNLDLAG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 302849248  81 ASTmcfpsaiwaidFATQRLNRTVTVNGCTGPITTFLIEPFVAHEEEFYLSITSTRNGWEVSFSEAGGIHIEENWDKLRT 160
gi 168022395  81 VES-----------FVKDRLGKEVEMSGTKGPITTFIVEPFVPHSDEFYLSIVSDRLGANISFSECGGIEIEENWEKVRS 149
gi 168000813  81 VVA-----------FVKERLGKEVEMSGTKGPITTFIVEPFVPHKDEYYLSIVSDRLGVNVSFSECGGIDIEENWDKVKA 149
gi 15217510   81 VAD-----------FVKARLGTEVEMEGCKAPITTFIVEPFVPHDQEYYLSIVSDRLGCTISFSECGGIEIEENWDKVKT 149
gi 224124562  81 VAE-----------FVKARLGAEVEMGGCKAPITTFIVEPFVPHDQEFYISIVSERLGSTISFSECGGIEIEENWDKVKT 149
gi 224124954  81 VAD-----------FVKARLGVEVEMGGCKAPITTFIVEPFVPHDQEFYFSIVSERLGCTISFSECGGIEIEENWDKVKT 149
gi 225450474  81 VAE-----------FVKARLGVEVEMGGCKAPITTFIVEPFVPHDQEYYLSIVSDRLGCTISFSECGGIEIEENWDKVKT 149
gi 255543008  81 VAE-----------FVKARLGVEVEMSGCKAPITTFIVEPFVPHDQEFYLSIVSERLGCTISFSECGGIEIEENWDKVKT 149
gi 297843736  81 VAA-----------FVKARLGTEVEMEGCKAPITTFIVEPFVPHDQEYYLSIVSDRLGCTISFSECGGIEIEENWDKVKT 149
gi 302775344  81 VEA-----------FVKERLGREVEMDGTKAPITTFIVEPFIPHDSEFYLSLVSHRLGVEISFSECGGIEIEENWEKVKT 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 302849248 161 VVLDTTDcPLDSARVAPLIAGLPLELKPALERFILAAFAVFNDLDCTLLEMNPWTLdASGQPFPLDMRVELDDTSKYRNG 240
gi 168022395 150 VFIPTEK-TLTSELCAPLIATLPLEVRPIIEAFLKGSFAVFEDLDFTLLEMNPFTL-VNNVPLPLDMRGELDDTALFKNF 227
gi 168000813 150 IFVPTEQsTLTSEICAPLVATLPLEVRPKIEEFLKGVFIVFSELDFTLLEMNPFTI-VDGTPYPLDMRGELDDTALFKNT 228
gi 15217510  150 IFLPAEK-SMTLEVCAPLIATLPLEVRAKIGNFIMGAFAVFQDLDFSFMEMNPFTL-VDGEPFPLDMRGELDDTAAFKNF 227
gi 224124562 150 IFLPTEK-PMTLEACAPLIATLPLEIRGKIGDFIISVFSVFQDLDFSFLEMNPFTL-VNGEPYPLDMRGELDDTAAFKNF 227
gi 224124954 150 IFLPTEK-PMTLEACAPLIATLPLEIRGKIVDFIICVFSVFQDLDFSFLEMNPFTL-VNGEPYPLDMRGELDDTAAFKNF 227
gi 225450474 150 INLPTEK-PMTPETCAPLIATLPLEVRGKIGDFIKGAFAVFQDLDFSFLEMNPFTL-VNGEPYPLDMRGELDDTAAFKNF 227
gi 255543008 150 VFLPTEK-PMNLEACAPLIATLPLEIRGKIGAFIMGVFAVFQDLDFSFIEMNPFTL-VNGEPYPLDMRGELDDTAAFKNF 227
gi 297843736 150 IFLPAEK-SMTLEVCAPLIATLPLEVRAKIGNFIMGAFAVFQDLDFSFMEMNPFTL-VDGEPYPLDMRGELDDTAAFKNF 227
gi 302775344 150 VFVPTEQ-PLTAETCAPLIATLPLEIRGKIETFIRGVFSVFEDLDFSLIEMNPFTL-VNGEPYPLDMRGELDDTALFKNF 227
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 302849248 241 PKWNvgdvELEFPLPFGRLLTPAEEAVSALDEATGASLKFTVLNPAGRVWLMVAGGGASVIYTDTIADLGFAQELGNYGE 320
gi 168022395 228 QKWG----NVEFPLPFGRTMTPAEESIHRMDEKTGASLKLTILNPKGRIWTMVAGGGASVIYADTVGDLGYAHELGNYAE 303
gi 168000813 229 QKWG----NVEFPLPFGRTMSPAEEKIHRMDEKTGASLKLTILNPEGRIWTMVAGGGASVIYSDTVGDLGFASELGNYAE 304
gi 15217510  228 NKWG----DIEFPLPFGRVLSSTENFIHGLDEKTSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAE 303
gi 224124562 228 KKWG----NVEFPLPFGRVLSSTESFIHSLDEKTSSSLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAE 303
gi 224124954 228 KKWG----NIEFPLPFGRVLSSTESFIHSLDEKTSASLKFTVLNQKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAE 303
gi 225450474 228 KTWG----NIEFPLPFGRVLSPTEGYIHSLDEKTSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAE 303
gi 255543008 228 KKWG----NIEFPLPFGRVLSPTESFIHSLDEKTSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAE 303
gi 297843736 228 NKWG----DIEFPLPFGRVLSSTESFIHGLDEKTSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAE 303
gi 302775344 228 QKWG----NVEFPVPFGRVMTPAEESIHKMDEKTGASLKLTILNPKGRIWTMVAGGGASVIYADTVGDLGYAHELGNYAE 303
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 302849248 321 YSGAPNTSETYQYARTVLDCATAHADGRGRVLLIGGGIANFTDVAATFTGIIQALKEKKAALQAAKVRIFVRRGGPNYQK 400
gi 168022395 304 YSGAPNEEETLQYARALIDCCTANPDGRKRALVVGGGIANFTDVAATFNGIIRAMREKQSHLKAARVNIFVRRGGPNYLK 383
gi 168000813 305 YSGAPNEEETLHFARALIDCCTANPDGRRRALVVGGGIANFTDVAATFNGIIRAFREKESQLKAARVQIYVRRGGPNYQK 384
gi 15217510  304 YSGAPNEEEVLQYARVVIDCATTDPDGRKRALLIGGGIANFTDVAATFNGIIRALREKETRLKASRMHIYVRRGGPNYQT 383
gi 224124562 304 YSGAPNEDEVLQYARVVIDCATSDPDGRKRALLIGGGIANFTDVAATFNGIIRALREKESKLKAARMHIYVRRGGPNYQT 383
gi 224124954 304 YSGAPNEEEVLQYARVVIDCATADPDGRKRALLIGGGIANFTDVAATFNGIIRALREKESKLKAARMHLYVRRGGPNYQT 383
gi 225450474 304 YSGAPNEEEVLQYARVVLDCATADPDGRKRALLIGGGIANFTDVAATFNGIVRALKEKESKLKASRMHIYVRRGGPNYQT 383
gi 255543008 304 YSGAPNEEEVLQYARVVIDCATADPDGRKRALLIGGGIANFTDVAATFNGIIRALREKESKLKAARMHIYVRRGGPNYQT 383
gi 297843736 304 YSGAPNEEEVLQYARVVIDCATADPDGRKRALLIGGGIANFTDVAATFNGIIRALREKETRLKASRMHIYVRRGGPNYQT 383
gi 302775344 304 YSGAPSEEETLHYARALIDCVTANPDGRRRALLIGGGIANFTDVAATFNGIIRALREKESQLKVAKVHIFVRRGGPNYQK 383
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|
gi 302849248 401 GLALMRSLGDELGVPIGVYGPESSMTGICAEAIDYLKQQD 440
gi 168022395 384 GLANMRALSEETGVPIEVYGPEASMTGICKQAIDYISARD 423
gi 168000813 385 GLAKMRELGAEIGIPIEVYGPEASMTGICKQAIDYISIAA 424
gi 15217510  384 GLARMRALGEELGVPLEVYGPEATMTGICKRAIDCIMLPD 423
gi 224124562 384 GLAKMRTLGEELGVPLEVYGPEATMTGICKQAIDCIMSTA 423
gi 224124954 384 GLAKMRTLGEEVGVPLEVYGPEATMTSICKQAIDCIMSTA 423
gi 225450474 384 GLARMRALGEELGIPLEVYGPEATMTGICKQAIDCIMSTA 423
gi 255543008 384 GLAKMRTLGEEVGVPLEVYGPEATMTGICKQAIDCIMSAA 423
gi 297843736 384 GLARMRALGEELGVPLEVYGPEATMTGICKRAIDCIMLPD 423
gi 302775344 384 GLERMRTLGRDIGIPIEVFGPEASMTGICRNAIDYIRVAA 423
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap