Conserved Protein Domain Family
PLN02169

?
PLN02169: PLN02169 
fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase
Statistics
?
PSSM-Id: 177826
View PSSM: PLN02169
Aligned: 2 rows
Threshold Bit Score: 981.418
Threshold Setting Gi: 15223657
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PLN02169 is a member of the superfamily cl12078.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297853618   1 MAMLGlleLFVAFLFSLVFLFTCFFIHKKPHGQPILKNWPFLGMLPGMLPQIPRIYDWTVEVLEASNLTFYFKGPWLSGT 80
gi 15223657    1 MAMLG---FYVTFIFFLVCLFTYFFLQKKPQGQPILKNWPFLRMLPGMLHQIPRIYDWTVEVLEATNLTFYFKGPWLSGT 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297853618  81 DMLFTADPKNINHILSSNFGNYPKGPEFKKIFDVLGEGILTVDLELWEDLRKSNHAMFHNQDFLELSLSSNKSKLKEGLV 160
gi 15223657   78 DMLFTADPRNIHHILSSNFGNYPKGPEFKKIFDVLGEGILTVDFELWEEMRKSNHALFHNQDFIELSVSSNKSKLKEGLV 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297853618 161 PFLDNAAHENIIIDLQDVFMRFMFDTSSILMTGYDPMSLSIEMLEVEFGEAADIGEEAIYYRHFKPVMLWRLQNWLGIGL 240
gi 15223657  158 PFLDNAAQKNIIIELQDVFQRFMFDTSSILMTGYDPMSLSIEMLEVEFGEAADIGEEAIYYRHFKPVILWRLQNWIGIGL 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297853618 241 ERKMRTALATVNRMFAKIISSRRKEEISRGETEP-SKDALTYYMNVDTTKYKLLKPKNDTFIRDVIFSLVLAGRDTTSSA 319
gi 15223657  238 ERKMRTALATVNRMFAKIISSRRKEEISRAKTEPySKDALTYYMNVDTSKYKLLKPNKDKFIRDVIFSLVLAGRDTTSSV 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297853618 320 LTWFFWLLSKNPQVMAKIRHEINTKYDPEDLEKLVYLHAALSESMRLYPPLPFNHKAPAKPDVLPSGHKVEPESKIVICI 399
gi 15223657  318 LTWFFWLLSKHPQVMAKLRHEINTKFDNEDLEKLVYLHAALSESMRLYPPLPFNHKSPAKPDVLPSGHKVDANSKIVICI 397
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297853618 400 YALGRMRSVWGEDASDFKPERWISDNGGLRHEPSYKYVAFNSGPRTCLGKHLALLQMKIVALEIIKNYDFKVIEGHKIEA 479
gi 15223657  398 YALGRMRSVWGEDALDFKPERWISDNGGLRHEPSYKFMAFNSGPRTCLGKNLALLQMKMVALEIIRNYDFKVIEGHKVEP 477
                        490       500
                 ....*....|....*....|
gi 297853618 480 IPSILLRMKHGLKVTVTKKM 499
gi 15223657  478 IPSILLRMKHGLKVTVTKKI 497
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap