Conserved Protein Domain Family
PLN00009

?
PLN00009: PLN00009 
cyclin-dependent kinase A; Provisional
Statistics
?
PSSM-Id: 177649
View PSSM: PLN00009
Aligned: 12 rows
Threshold Bit Score: 587.94
Threshold Setting Gi: 302836614
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159481134   1 MDKYEKLERAGEGTYGVVFKARDRYTNEIVALKKIRLEQEDEGVPSTAIREISFLKELRHDNVVRLYDVLYSDRRLYLVF 80 
168057033   1 MEQYEKVEKIGEGMYGVVYKARDRVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMHHGNIVRLQDVVHSEKRLYLVF 80 
115450343   1 MEQYEKEEKIGEGTYGVVYRARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMHHGNIVRLHDVIHSEKRIYLVF 80 
115443903   1 MEQYEKVEKIGEGTYGVVYKGKHRHTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHRNIVRLQDVVHKEKCIYLVF 80 
18408696    1 MDQYEKVEKIGEGTYGVVYKARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHSNIVKLQDVVHSEKRLYLVF 80 
224080065   1 MDQYEKVEKIGEGTYGVVYKARDRVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSEKRLYLVF 80 
242060276   1 MDQYEKTEKIGEGTYGVVYKGKDRHTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHRNIVRLQDVVHNDKCIYLIF 80 
225464305   1 MYQYEKVEKIGEGTYGVVYKARDRVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSEKRLYLVF 80 
302753412   1 MEQYEKVEKIGEGTYGVVYKARDRITNETIALKKIRLDQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHCEKKLYLVF 80 
302804516   1 MEQYEKVEKIGEGTYGVVYKARDRITNETIALKKIRLDQEDEGVPSTAIREISLLKEMQHGNIVRLQDVVHCEKKLYLVF 80 
302836614   1 MDKYERLERAGEGTYGVVFKARDRYTNEIVALKKIRLEQEDEGVPSTAIREISFLKELRHDNVVRLYDVLYSDRRLYLVF 80 
297816080   1 MDQYEKVEKIGEGTYGVVYKARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHSNIVKLQDVVHSEKRLYLVF 80 
159481134  81 EFLDLDLKKQMDQTPNFSRNQRVIKMYMWQMLSGIAFCHSRRILHRDLKPQNLLIDRSRNTLKLADFGLARAFGIPVRAY 160
168057033  81 EYLDLDLKKHMDTCPDLAKDPRLIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTF 160
115450343  81 EYLDLDLKKFMDSCPEFAKNPTLIKSYLYQILRGVAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTF 160
115443903  81 EYLDLDLKKHMDSSPDF-KNHRIVKSFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVRTF 159
18408696   81 EYLDLDLKKHMDSTPDFSKDLHMIKTYLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVRTF 160
224080065  81 EYLDLDLKKHMDSSPEFANDPRLVKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTF 160
242060276  81 EYLDLDLKKHMDSSADF-KNHRIVKSYLYQILRGLAYCHSHRVLHRDLKPQNLLLDRRNNILKLADFGLARAFGIPVRTF 159
225464305  81 EYLDLDLKKHMDSSPDFAKDLRLIKMFLHQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTF 160
302753412  81 EYLDLDLKKHMDNSPDFAKSPRMIKTFLYQMIRGLAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTF 160
302804516  81 EYLDLDLKKHMDNSPDFAKSPRMIKTFLYQMIRGLAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTF 160
302836614  81 EYLDLDLKKQMDAAP-FNRNLRLIKVYMWQMLSGIAFCHSRRILHRDLKPQNLLIDRSRNQLKLADFGLARAFGIPVRAY 159
297816080  81 EYLDLDLKKHMDSTPDFSKDLHMIKTYLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVRTF 160
159481134 161 THEVVTLWYRAPEILLGSKTYSTPVDIWSIGCIFAEMVNHRPLFPGDSEIDQLHKIFQLLGTPDEAMWAGCSALPDFKDT 240
168057033 161 THEVVTLWYRAPEILLGSCHYSTPVDVWSVGCIFAEMVTQRPLFPGDSEIDELFRIFRLLGTPTEETWPGVTSLPDFKSA 240
115450343 161 THEVVTLWYRAPEILLGSRQYSTPVDMWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRVLGTPNEQSWPGVSSLPDYKSA 240
115443903 160 THEVVTLWYRAPEILLGARHYSTPVDMWSVGCIFAEMVNQKPLFPGDSEIDELFKIFSIMGTPNEETWPGVASLPDYIST 239
18408696  161 THEVVTLWYRAPEILLGSHHYSTPVDIWSVGCIFAEMISQKPLFPGDSEIDQLFKIFRIMGTPYEDTWRGVTSLPDYKSA 240
224080065 161 THEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRILGTPNEDTWPGVTSLPDFKSA 240
242060276 160 THEVVTLWYRAPEILLGARHYSTPVDVWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRILGTPTEGTWPGVATLPDYKST 239
225464305 161 THEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVLGTPNEDTWPGVTSLPDFKSA 240
302753412 161 THEVVTLWYRAPEILLGSRHYSTPVDMWSVGCIFAEMINQRPLFPGDSEIDELFKIFRILGTPNEETWPGVTSLPDFKSA 240
302804516 161 THEVVTLWYRAPEILLGSRHYSTPVDMWSVGCIFAEMINQRPLFPGDSEIDELFKIFRILGTPNEETWPGVTSLPDFKSA 240
302836614 160 THEVVTLWYRAPEILLGSKTYSTPVDIWSIGCIFAEMVNNKPLFPGDSEIDQLYKIFQLLGTPDETMWVGCSALPDYKDT 239
297816080 161 THEVVTLWYRAPEILLGSHHYSTPVDIWSVGCIFAEMISQKPLFPGDSEIDQLFKIFRIMGTPYEDTWRGVTSLPDYKSA 240
159481134 241 FPKWRPQNLGAAVPTLSPEGVDLLARMLVYTPQHRITASAAMEHAYFNEIRDTM 294
168057033 241 FPKWPAKNVGSVVPGLEPLGIDLLSKMLILEPSRRITARTALEHEYFKDVGLVP 294
115450343 241 FPKWQAQDLATIVPTLDPAGLDLLSKMLRYEPNKRITARQALEHEYFKDLEMVQ 294
115443903 240 FPKWPSVDLATVVPTLDSSGLDLLSKMLRLDPSKRINARAALEHEYFKDLEVA- 292
18408696  241 FPKWKPTDLETFVPNLDPDGVDLLSKMLLMDPTKRINARAALEHEYFKDLGGMP 294
224080065 241 FPKWPSKDLATVVPTLEKAGVDLLSKMLFLDPTKRITARSALEHEYFKDIGFVP 294
242060276 240 FPKWPSMDLATVVPTLEPAGIDLLSKMVRLDPSKRITARAALEHEYFRDLEHAY 293
225464305 241 FPKWPPKDLATVVPNLESAGIDLLSKMLCLDPSRRITARSALEHEYFKDIGFVP 294
302753412 241 FPKWLPKDLATLVPGLEHAGVDLLSKMLCLDPSSRITARAALEHDYFKDAASAG 294
302804516 241 FPKWLPKDLATLVPGLEHAGVDLLSKMLCLDPSSRITARAALEHDYFKDAASAG 294
302836614 240 FPKWRPQNLAAAVPTLGPQGVDLLARMLVYTPQHRITASAALDHPYFDEIRDQM 293
297816080 241 FPKWKPTDLESFVPNLDPDGVDLLSKMLLMDPTKRINARAALEHEYFKDLGVMP 294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap