Conserved Protein Domain Family
PHA00733

?
PHA00733: PHA00733 
hypothetical protein
Statistics
?
PSSM-Id: 177301
View PSSM: PHA00733
Aligned: 10 rows
Threshold Bit Score: 190.857
Threshold Setting Gi: 270281772
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42494954   20 ERVMRDSGSERH-LiykSNHKGITIHVTLEELERYHSLTPEQKRIIRAIVKTLIYNPQLLSESSYLYKLLTTKAISPYVC 98
gi 42495078   31 GGIGMESGNKNY-L---SNHKTLGIHVTLEELKRYHSLTPEQKRLIRTIVKTLIYRPDLLENAQYLIKLAESKAVSPYVC 106
gi 9625538     2 TESDVDSGSKKY-L---SNHKGIFIHVTLEELKRYHQLTPEQKRLIRAIVKTLIHNPQLLDESSYLYRLLASKAISQFVC 77
gi 38639824   28 GGIGMESGSKKY-L---SNHKGIMIHVTLEELKRYHSLTPEQKRIIRAVVKALIHNPQLLDESGYLYKLLASKAVSPYVC 103
gi 160688447   1 ----MESGSKKY-L---SNHKGIMIHVTLEELKRYHSLTPEQKRIIRAVVKTLIHNPQLLDESGYLYKLLTSKAVSPYVC 72
gi 198449258   1 ----MESGSKKY-L---SNHKGIMIHVTLEELKRYHSLTPEQKRIIRAVVKTLIHNPQLLDESGYLYKLLTSKAVSPYVC 72
gi 270281809   1 ---MSQSDIKKY------QNKGIFFHLSKKEYERYKSLPPEQKKLIRAVIKALIYNPDLLSEADYLFKLMQSKTVSPYVC 71
gi 270281772   1 -----MPDIKKYqVshgKENKGVFFHLSSEEYEIYKNLPEEQKRALRLLIKTLIRNPNLLNDN--LVKYAMLKSINTFTC 73
gi 270281768  10 GEKMTESGTKKY-L---SNHKGIMIHVSLEELTRYHSLRPEQKRLIRAFVKMLIYYPQLLDESSYLYKLLTVKAVSPYVC 85
gi 270281841   1 MGIGMESGSKKY-L---SNHKGIMIHVTLEELKRYHSLTPEQKRIIRAVVKTLIHNPQLLDESGYLYKLLTSKAVSPYVC 76
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 42494954   99 PLCLTPFSSSASLKQHIRYAEHTKICPVCEKAFQKTDALLDHVCKKHNICVS 150
gi 42495078  107 PLCLMPFSSSVSLKQHIRYKEHAKTCPVCGKKFRNTDSTIDHVCKKHNICVS 158
gi 9625538    78 PLCLMPFSSSVSLKQHIRYTEHTKVCPVCKKEFTSTDSALDHVCKKHNICVS 129
gi 38639824  104 PLCLMPFSSSVSLKQHIRYTEHSKVCPVCGKEFRNTDSTLDHVCKKHNICVS 155
gi 160688447  73 PLCLMPFSSFVSLKQHIRYTEHSKVCPVCGKEFRNTDSTLDHVCKKHNICVS 124
gi 198449258  73 PLCLMPFSSFVSLKQHIRYTEHSKVCPVCGKEFRNTDSTLDHVCKKHNICVS 124
gi 270281809  72 PLCLTPFSSSVSLKQHIRYTEHSKVCPVCGKEFRNTDSTLDHVCKKHNICVS 123
gi 270281772  74 PICLMPFSSYKGLIEHIRYTTHNLKCRYCGKTFTSQDALLDHICKKHNICVS 125
gi 270281768  86 PLCLTPFHSFASLKQHIRYAEHTTTCPVCKKQFQKTDTLLDHVCKKHNICVS 137
gi 270281841  77 PLCLMPFSSSVSLKQHIRYTEHSKTCPVCGKEFRNTDSTLDHVCKKHNICVS 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap