Conserved Protein Domain Family
PI-PLCc_delta3

?
cd08630: PI-PLCc_delta3 
Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta3
This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-delta3 isozymes. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PLC-delta represents a class of mammalian PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, and a C-terminal C2 domain. This family corresponds to the catalytic domain which is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. There are three PI-PLC-delta isozymes (1,3 and 4). Unlike PI-PLC-delta 4, PI-PLC-delta1 and 3 possess a putative nuclear export sequence (NES) located in the EF-hand domain, which may be responsible transporting PI-PLC-delta1 and 3 from the cell nucleus.
Statistics
?
PSSM-Id: 176567
View PSSM: cd08630
Aligned: 3 rows
Threshold Bit Score: 499.933
Threshold Setting Gi: 76644873
Created: 9-Mar-2010
Updated: 20-Aug-2013
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on the structure evidence of the catalytic site in Rat Phosphoinositide-specific phospholipase C-Delta1.
  • Citation:PMID 9048554

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                        #                                            #                  
gi 158706388 336 FQDMNQPLAHYFISSSHNTYLTDSQIGGPSSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQAVR 415
gi 158706191 312 YQDMSKPLAHYYISSSHNTYLTKDQVTSASSTEPYIRALNQGCRCVELDCWDGDKGEPIIYHGHTLTSKVLFKEVIETIA 391
gi 76644873  332 FQDMDQPLAHYFISSSHNTYLTDSQIGGPSSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVIQAVR 411
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 158706388 416 DHAFTLSPYPVILSLENHCGLEQQAAMARHLCTILGDMLVTQALDSpnpEELPSPEQLKGRVLVKGKKLpaarsedgral 495
gi 158706191 392 QYAFKASPYPLILSLENHCSVEQQAIMAQQLQSILGKKLLAKPLSDlplKQLPSPEELKGRILLKGKKLngllgkteswt 471
gi 76644873  412 EHAFTVSPYPVILSLENHCGLEQQAAMARHLHTILGDMLVTQTLDSqnpEELPSPERLKGRVLVKGKKLpdtrsengcil 491
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 158706388 496 sdreeeee--ddeeeeeeveaaaqrrlakQISPELSALAVYCHATRLRTLHPApnaPQPCQVSSLSERKAKKLIREAGNS 573
gi 158706191 472 sftnssdeesvaggnkkeskkdlarsastKLSPELSDLVVYCQSVPFSGFETAn-qRPPSVITSFSENEALKLIKDSGKL 550
gi 76644873  492 sereeede---eedeeeelgaveqrrrakQISPELSALAVYCCATRLRTLRPPpvpPQPCQVSSLSERKAKKLIREAGNS 568
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*...
Feature 1                                                                  
gi 158706388 574 FVRHNARQLTRVYPLGLRMNSANYSPQEMWNSGCQLVALNFQTPGYEMDLNAGRFLVN 631
gi 158706191 551 FVRNNSRQLSRIYPSAQRLQSSNFDPQDMWNAGCQMVALNFQTPGEQMDLNQGRFLPN 608
gi 76644873  569 FVRHNARHLTRVYPLGLRMNSANYSPQEMWNSGCQLVALNFQTPGYEMDLNAGRFLVN 626

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap