Conserved Protein Domain Family
PI-PLCc_plant

?
cd08599: PI-PLCc_plant 
Catalytic domain of plant phosphatidylinositide-specific phospholipases C
This family corresponds to the catalytic domain present in a group of phosphoinositide-specific phospholipases C (PI-PLC, EC 3.1.4.11) encoded by PLC genes from higher plants, which are homologs of mammalian PI-PLC in terms of overall sequence similarity and domain organization. Mammalian PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. The domain arrangement of plant PI-PLCs is structurally similar to the mammalian PLC-zeta isoform, which lacks the N-terminal pleckstrin homology (PH) domain, but contains EF-hand like motifs (which are absent in a few plant PLCs), a PLC catalytic core domain with X- and Y- highly conserved regions split by a linker sequence, and a C2 domain. However, at the sequence level, the plant PI-PLCs are closely related to the mammalian PLC-delta isoform. Experiments show that plant PLCs display calcium dependent PLC catalytic properties, although they lack some of the N-terminal motifs found in their mammalian counterparts. A putative calcium binding site may be located at the region spanning the X- and Y- domains.
Statistics
?
PSSM-Id: 176541
View PSSM: cd08599
Aligned: 9 rows
Threshold Bit Score: 349.748
Threshold Setting Gi: 116059156
Created: 30-Sep-2009
Updated: 20-Aug-2013
Structure
?
Aligned Rows:
 
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Comment:Based on structure evidence of the catalytic site in Homo sapiens phospholipase C beta 2.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                        #                                                     #         
gi 75306038  113 HQNMDAPLSHYFIFTGHNSYLTGNQLSSNCSeLPIADALRRGVRVVELDLWPRgt---------ddVCVKHGRTLTkeVK 183
gi 148906994 106 HHDMTAPLSHYFIYTGHNSYLTGNQLSSDCSdAPIIKALNRGVRVIELDIWPNsak--------ddVLVLHGRTLTspVE 177
gi 38603638  105 HQDMTQPLSHYFIFTGHNSYLTGNQLSSDSSdVPIAAALQRGVRVVELDLWPDdk---------ggIKVTHGNTLTspVA 175
gi 168028609 125 THDMTRPLSHYYIYASHNSYLTGNQLTSSSSiVPIIEALRNGCRVIELDCWEKqgqqcwsgstnndIVVLHGNTLTsaIP 204
gi 51090376  147 TDDMNAPLSDYYIFSSHNTYLMGNQLCSPSStAPIVKALLDGCRVIELDCWNGsn---------krIDVLHGGTLTkaVP 217
gi 226462628 110 VSSMNEPLSHYFINSSHNTYLSGDQLFSRSLtFAIKRALLHGCRVIELDCYDGgr---------egPVVMHGITATqsIT 180
gi 116059156 116 ESEMTSEMSAYFVNSSHNTYLDGDQLFSRASvAAIAGALDRGCRVIELDVYDGkkrg-----dkprPIVTHGGTAVrpMY 190
gi 75313893  104 HHDMHAPLSHYFIHTSLNSYFTGNVFGKYSI-LPIIEALEQGVRVVELDLWPDgr---------gsICVRPSWNFEkpLK 173
gi 159476806  31 YQDMKQPLSHYFVSSGHNSYLTGNQLTSASGtATIIACLQGSCRVIELDVYNG-------------PECKHGGTLTkaIS 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 75306038  184 LGKCLESIKANAFAISKYPVIITLEDHLTpkLQFKVAKMITQTFGDMLYYHDSQgc----qeFPSPEELKEKILISTKPP 259
gi 148906994 178 FIKCIRSIKEHAFVASQYPVIITLEDHLTrdLQAKAAETITKTFGELLYYPKSEvl----eeFPSPESLKGRIIISTKPP 253
gi 38603638  176 FEKCIKAIKANAFVSSKYPVVITLEDHLSspLQALAAETLTNILGEDLYYPPSSdgf---keLPSPESLKGKILISTKPP 252
gi 168028609 205 FKDCVIAIKENAFIASQYPVIITIENHMGaeMQKKAALVLREILGESLFYPSREqrp--plqFESPEVLKGFIIVSDQPP 282
gi 51090376  218 FEDCVKAIKDNAFTTSAYPVVVTIESHLDleHQKEAARVLNKILGNIMFVPPPNelp--pqsFRSPEQLKHRIIISDKPP 295
gi 226462628 181 FRNALKTIKQDAHTTSEYPVIITMENHCSklKRVELAKILLEELGDKLFIPLSLhl----nqWPSPSELKGRILIRDKIG 256
gi 116059156 191 FEDAIKVIAERAHVASEYPVIVTLENHASkeTRAEMSRILRSTLGDKLWAPKSAvagnqlkrWPSPLELKGRVIVRDKIK 270
gi 75313893  174 LQECLDSIKEHAFTKCTYPLIITFKDGLKpeLQSKATQMIQQTFNHMVYHHDPHsl----evFPSPQQLRNKILISRRPP 249
gi 159476806  98 FKECIEAIGEYAFKASPYPVIITMENHANteNQGLMAQILREVLGDKLFVPHPDdpm---eaWKSPEELKHKVVCRTSLK 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 75306038  260 keyleandtkekdngekgkdsdedvwgkepedlistqsdldkvtssvnd------------------------------- 308
gi 148906994 254 keyletkttelqgdgdkeklktpdeepwgddipdygpdvpneresadpagp----------------------------- 304
gi 38603638  253 keyleaavaqksalkdekilnelkkadklqeqstapvkspvekkiavppsektksiseekdlsekvgnlrvdsegesadp 332
gi 168028609 283 sdtiedqlavdpnaaqvlatdelddahastsdhtrhaqrlkkhikrahkkavlrv------------------------- 337
gi 51090376  296 gdallsqaanepefaqqtllhevvrdpspdnrhehrhgrrgkkkklrrrqsqiae------------------------- 350
gi 226462628 257 tkqvlreasgspylvrtqpipicrrfvdnaediarfeisddvtnreepceafsy-------------------------- 310
gi 116059156 271 hkqdelqrrrdqrrglcglcgtkkqskqrkvlpkslnvrkndkvcamqsiie---------------------------- 322
gi 75313893  250 kellyandddgkvgvrngveir---------------------------------------------------------- 271
gi 159476806 175 pnaheefkkliyiknskftglaemikkggvvvlrg--------------------------------------------- 209
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 75306038  309 -------lnqddeergscesdtscqlqapeykrliaihagkpkgglrmalkvdpnkIRRLSLSEQLLEKava-----syG 376
gi 148906994 305 ------ieedsgddegisqvnpdkdvapeykrlitiragkpkgvslkdsirvdgkqVKRVSLSEPQLQKvar-----shP 373
gi 38603638  333 apasspdgkkatltadsesddddnkknpeyarlitihqskpskgttvedrlkvegtVVRISLSETKLEKvte-----efP 407
gi 168028609 338 --antaakvlrksllvekievpetvefqeliylycakpsemkkakheegplvggdrAIMANLSEPQLQHfia-----rhP 410
gi 51090376  351 --sriqklpsgklgdsgrpaiandpafdellyihcqkptemataqkkggplikgqhAIMANLSESQLDDlie-----dhT 423
gi 226462628 311 ---fnfkfmrstnsyepptpssekvkqqvcnemfkslisienikikvikealeierVISCSWDELTLNNrkw----aldK 383
gi 116059156 323 -----fprsstgvfdegavsssssdsegeqddedlkrivsvpnvkfrsfheardvpRFSCSWSERKLKLkie----kesS 393
gi 75313893  272 -----------------------------------qhpadpnyqslvsfhvveprgMLQNVLTGKANKIqrp----gwyE 312
gi 159476806 210 ----------------------dvkelgaddadeeretqremeklqaqqakakaagHEGNSADETPEDAvvgggmvtgsI 267
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                    
gi 75306038  377 ADVIRFTqKNFLRIYPKGTRFNSSNYKPQIGWMSGAQMIAFNMQGYGRALWLMEGMFRAN 436
gi 148906994 374 THVVRFThNNFLRIYPKGTRIDSSNYNPLLAWTHGAQMVAFNMQGYGRQLWLVHGFFRAN 433
gi 38603638  408 ELVVKFTqRNILRVYPAGNRVNSSNYDPTAAWIHGAQMVAQNMQGYGKELWQAHGKFRGN 467
gi 168028609 411 GSLIEYSkMNLGRVYPFGLRFNSSNADPMLAWSHGFQIAALNLQGRDRPVWLAKGFFQVN 470
gi 51090376  424 DSLIEFSkTNLTRVYPFGLRVTSSNADPMDAWEHGVQVAAINMQGRDRPVWISKAIFSRN 483
gi 226462628 384 ATMLDFTgRHLLRCYPNRRRVTSQNFDPSLAWSMGAQMVALNFQTNDLAMWLNRGKFVAN 443
gi 116059156 394 KDIIEFTnAHLLRTYPAGHRIFSNNYDPSEAWDVGASFVALNFQALDRYVWANRAKFRVN 453
gi 75313893  313 TDIISFTqKRFLRTRPQRKLLIYAPYKPQRAWMHGAQLIALSRKEEKEKLWLMQGMFRAN 372
gi 159476806 268 QELYTYTgKHLMRVYPAGWRITSGNYNPMTAWIRGASFAALNWQVWDKPLWCNAGKFLDN 327

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap