1DJG,1QAS,1DJX


Conserved Protein Domain Family
PI-PLCc_delta

?
cd08593: PI-PLCc_delta 
Click on image for an interactive view with Cn3D
Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta
This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-delta isozymes. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PLC-delta represents a class of mammalian PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, and a C-terminal C2 domain. This CD corresponds to the catalytic domain which is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. There are three PI-PLC-delta isozymes (1,3 and 4). PI-PLC-delta1 is relatively well characterized. It is activated by high calcium levels generated by other PI-PLC family members, and therefore functions as a calcium amplifier within the cell. Different PI-PLC-delta isozymes have different tissue distribution and different subcellular locations. PI-PLC-delta1 is mostly a cytoplasmic protein, PI-PLC-delta3 is located in the membrane, and PI-PLC-delta4 is predominantly detected in the cell nucleus. Aside from three PI-PLC-delta isozymes identified in mammals, some eukaryotic PI-PLC-delta homologs have been classified to this CD.
Statistics
?
PSSM-Id: 176535
View PSSM: cd08593
Aligned: 18 rows
Threshold Bit Score: 472.207
Threshold Setting Gi: 198415277
Created: 2-Oct-2009
Updated: 20-Aug-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic site [active site]
Evidence:
  • Comment:Both prokaryotic and eukaryotic PI-PLCs utilize a similar catalytic mechanism, a general base and acid catalysis involving two well conserved histidines. It consists of two steps, a phosphotransfer and a phosphodiesterase reaction.
  • Structure:1DJX; Rat Phosphoinositide-specific phospholipase C-Delta1 catalytic residues are well conserved in all eukaryotic PI-PLCs.
    View structure with Cn3D
  • Citation:PMID 9048554

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                        #                                            #                  
1DJG_A       163 YQDMDQPLSHYLVSSSHNTYLLEDQLTGPSStEAYIRALCKGCRCLELDCWDGPNqEPIIYHGYTFTSKILFCDVLRAIR 242
gi 74732863  289 YQDMTQPLNHYFICSSHNTYLVGDQLCGQSSvEGYIRALKRGCRCVEVDVWDGPSgEPVVYHGHTLTSRILFKDVVATVA 368
gi 42794334  298 YQDMKQPLAHYFINSSHNTYLLDDQLRGPSStEAYISALQRGCRCVELDCWDGPDnDPIVYHGHTLTSKIKFRDIIEVVD 377
gi 215503614 313 CQDMSQPLNHYYIASSHNTYLVQGQLMGSSSvEGYIRALKKGCRCLELDVWDGPNnEPVVYHGYTLTSKILFRDILDSVK 392
gi 156375851 206 YQDMRQPLSHYFIASSHNTYLMEDQLKGPSSvDAYINAFNKGCRCVELDCWDGDNgDPIVYHGHTLTSKIKFKDIIQAVA 285
gi 260783682  31 YQDMTQPLSHYFIASSHNTYLLEDQIRGPSSkEGYVRVLLKGCRFLELDCWDGDDgEPVIYHGYTLTSKVLFRDVIEAIG 110
gi 156355400  91 YQDMNQPLSHYFIASSHNTYLLGHQLKGSSSvQAYRDVLERGCRCVELDCWDGDDeEPIVYHGHTLTSKVLFKDIVQAIK 170
gi 198437813 312 HMDMTRPLSHYYIASSHNTYLADDQLIGKSSvECYIRALERGCRCVELDCWDGEDgQPIIYHGYTLTSKIAFADVVEAIR 391
1DJX_B       163 YQDMDQPLSHYLVSSSHNTYLLEDQLTGPSStEAYIRALCKGCRCLELDCWDGPNqEPIIYHGYTFTSKILFCDVLRAIR 242
gi 158706191 312 YQDMSKPLAHYYISSSHNTYLTKDQVTSASStEPYIRALNQGCRCVELDCWDGDKgEPIIYHGHTLTSKVLFKEVIETIA 391
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1DJG_A       243 DYAFKASPYPVILSLENHCSLEQQRVMARHLRAILGPILLDQPLDgvt-tsLPSPEQLKGKILLKGKKLggllpaggeng 321
gi 74732863  369 QYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDgvlptqLPSPEELRRKILVKGKKLtleedleyeee 448
gi 42794334  378 KYAFAASEYPLILSFENHCSVEQQKVMAQICVSILKDKLYTNNNLhne-aaFPSPEELKGKILIKGKSLppsaatteddg 456
gi 215503614 393 LYAFEDSQYPVILSLENHCSTEQQKVMAKHLVEILGDKLHNKPISdke-taMPPPSALLNKILIKGKKLnkdlsvdaddd 471
gi 156375851 286 EHAFKVSDYPVILSLENHCNIENQRKIAEHLENILGDKLFKDPVDtal-tsLPSPESLKGKVLIKGKKLkpeqemaavge 364
gi 260783682 111 RYAFKASPYPVFLSLENHCSVVQQRLLATHMVNILGDSLCNIPSTpdm-qeLPSPQRLRGKIIVKNKKLkrnvveddvsd 189
gi 156355400 171 ESAFKVSPYPVIVSLENHCSVQFQIKMAEHLKGILGSLLYTTPVDftl-daLPSPKFFLNKILVRGKTGksivddkemdk 249
gi 198437813 392 DYAFKTSDYPVILSIENHCSVPQQKKMALIMKETLGDMLLQNPVDpss-hmLPSPEALKGRILVKGKRLketnedeevsd 470
1DJX_B       243 DYAFKASPYPVILSLENHCSLEQQRVMARHLRAILGPILLDQPLDgvt-tsLPSPEQLKGKILLKGKKLggllpaggeng 321
gi 158706191 392 QYAFKASPYPLILSLENHCSVEQQAIMAQQLQSILGKKLLAKPLSdlplkqLPSPEELKGRILLKGKKLngllgkteswt 471
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1DJG_A       322 seatdvsdeve------aaemedeavrsqvqhkpkedklKLVPELSDMIiYCKSVHFGGFSspgtsgqaFYEMASFSESR 395
gi 74732863  449 eaepeleeselalesqfetepepqeqnlqnkdkkkkskpILCPALSSLViYLKSVSFRSFThske-hyhFYEISSFSETK 527
gi 42794334  457 evsdedeaadi------dtedpqlkaeldkkkttskkklKLAKELSDLV-TLASVHYGSFPaske-kykCHQMSSFGEAK 528
gi 215503614 472 sedestskvngtp--lslvsecpnharfgrelsphptsgTLAEELSNIVnYCKASHFKSFEeae--kwhFYEMASFSEGK 547
gi 156375851 365 ddgtvsdedea------adieqedlaaaregeeskekkvKLAKELSRCVnYISSVGFKNFEhske-nakFYQMSSFVESK 437
gi 260783682 190 edeaa------------------etedvevqervktskeKLAKELSDLVnICEAVHFHSFQhsre-ndmPYNMSSIKEGK 250
gi 156355400 250 eidsfdr--------------kvqiersvqetdfrgtkeHVADELSQLInYISNEKFKSFIesme-mghFSQTHSFVESE 314
gi 198437813 471 edeaad----------------veengvkknpsktnkkiKLSKELSDLViYAQSRHFHNFPdakh-nsdFRHISSLNEDK 533
1DJX_B       322 seatdvsdeve------aaemedeavrsqvqhkpkedklKLVPELSDMIiYCKSVHFGGFSspgtsgqaFYEMASFSESR 395
gi 158706191 472 sftnssdee----------svaggnkkeskkdlarsastKLSPELSDLVvYCQSVPFSGFEtan--qrpPSVITSFSENE 539
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
Feature 1                                                                               
1DJG_A       396 ALRLLQ--ESGNGFVRHNVSCLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYLGCFQDN 464
gi 74732863  528 AKRLIK--EAGNEFVQHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICDGHFRQN 596
gi 42794334  529 AFGLAE--DKPGDYVEHNKIFLSRIYPGGLRTNSSNYSPVPMWDVGAQIVALNFQTPCEEMDLNQGKFLQN 597
gi 215503614 548 AAKLSStdQGARDFVRYNSKHLSRIYPKGTRTDSSNYDPVRYWNVGCQIVALNYQSWDQKMFMNEAKFSMN 618
gi 156375851 438 VATLAQ--NKAAGFVEYNTRQLSRTYPAGSRVDSSNYNPQVAWNVGCQIVALNYQTDGEYMHLNQGRFREN 506
gi 260783682 251 ANHLVE--EQAADFIDHTKRQLVKIYPSGGRVDSSNIDPYLYWSVGCQIVALNYQTPCDQMDLNLGLFRQN 319
gi 156355400 315 MLYFLD--KSASEFVEFNKHQISRIYPGNLRVDSSNYDPIKPWTVGCQIVALNHQTNSEEMQLHYGKFRQN 383
gi 198437813 534 AMNLYN--SQAEEFSEHNQWQLVRIYPKGTRTNSSNYDPLALWNVGCQIVALNYQTEDRETHINDALFRRN 602
1DJX_B       396 ALRLLQ--ESGNGFVRHNVSCLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYLGCFQDN 464
gi 158706191 540 ALKLIK--DSGKLFVRNNSRQLSRIYPSAQRLQSSNFDPQDMWNAGCQMVALNFQTPGEQMDLNQGRFLPN 608

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap