Conserved Protein Domain Family
GDX_N

?
cd01807: GDX_N (this model, PSSM-Id:176402 is obsolete and has been replaced by 340505)
ubiquitin-like domain of GDX
GDX contains an N-terminal ubiquitin-like domain as well as an uncharacterized c-terminal domain. The function of GDX is unknown.
Statistics
?
PSSM-Id: 176402
Aligned: 3 rows
Threshold Bit Score: 130.407
Threshold Setting Gi: 13385770
Created: 8-May-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P11441      1 MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPL 74  human
NP_080537   1 MFLTVKLLLGRRCSLKVSGKESVATLKKLVSQHLQVPEEQQHLLFRGQLLADDKYLSDYSIGPNASINVIMRPP 74  house mouse
AAH49498    1 MILTVKPLQGKECNVQVTENEKVSTVKELVSERLNIPASQQRLLYKGKALADEHRLSDYSIGPEAKLNLVVRPA 74  zebrafish
NP_080537   1 MFLTVKLLLGRRCSLKVSGKESVATLKKLVSQHLQVPEEQQHLLFRGQLLADDKYLSDYSIGPNASINVIMRPP 74  house mouse
AAH49498    1 MILTVKPLQGKECNVQVTENEKVSTVKELVSERLNIPASQQRLLYKGKALADEHRLSDYSIGPEAKLNLVVRPA 74  zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap