Conserved Protein Domain Family
Hoil1_N

?
cd01799: Hoil1_N (this model, PSSM-Id:176394 is obsolete and has been replaced by 340497)
Ubiquitin-like domain of HOIL1
HOIL1_N HOIL-1 (heme-oxidized IRP2 ubiquitin ligase-1) is an E3 ubiquitin-protein ligase that recognizes heme-oxidized IRP2 (iron regulatory protein2) and is thought to affect the turnover of oxidatively damaged proteins. Hoil-1 has an amino-terminal ubiquitin-like domain as well as an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain.
Statistics
?
PSSM-Id: 176394
Aligned: 4 rows
Threshold Bit Score: 132.675
Threshold Setting Gi: 31239203
Created: 8-May-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9BYM8     47 LWVSVEDAQMHT-VTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQW-VIGQRLARDQETLHSHGVRQNGDSAYLYLL 121 human
CAG07086   66 LHVGVEDAQSETyILVTVVVSPHMTIAQLKDKISEDYGFPPAVQRW-VIGKRLAQDRETLYSHGVRMDGDQAFLFIL 141 Tetraodon nigroviridis
XP_320015   1 LNVYIDDKVSHK-GPIRMTLAAFATLAQLKAKLCNEYQIPVAVQRWrCDDQPLDDDTRTLYDYGIQTSDRTLFVYIV 76  Anopheles gambiae str...
BAA33957   47 LCVSVEDAYMHT-VTIWLTVRPDMTVASLKDMVFLDYGFPPSLQQW-VVGQRLARDQETLHSHGIRRNGDSAYLYLL 121 Norway rat
CAG07086   66 LHVGVEDAQSETyILVTVVVSPHMTIAQLKDKISEDYGFPPAVQRW-VIGKRLAQDRETLYSHGVRMDGDQAFLFIL 141 Tetraodon nigroviridis
XP_320015   1 LNVYIDDKVSHK-GPIRMTLAAFATLAQLKAKLCNEYQIPVAVQRWrCDDQPLDDDTRTLYDYGIQTSDRTLFVYIV 76  Anopheles gambiae str...
BAA33957   47 LCVSVEDAYMHT-VTIWLTVRPDMTVASLKDMVFLDYGFPPSLQQW-VVGQRLARDQETLHSHGIRRNGDSAYLYLL 121 Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap