3BLH,3BLQ


Conserved Protein Domain Family
STKc_CDK9

?
cd07865: STKc_CDK9 (this model, PSSM-Id:173754 is obsolete and has been replaced by 270848)
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9
Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multiple steps of gene expression including transcription elongation, mRNA synthesis, processing, export, and translation. It also plays a role in mediating cytokine induced transcription networks such as IL6-induced STAT3 signaling. In addition, the CDK9/cyclin T2a complex promotes muscle differentiation and enhances the function of some myogenic regulatory factors.
Statistics
?
PSSM-Id: 173754
View PSSM: cd07865
Aligned: 14 rows
Threshold Bit Score: 563.154
Threshold Setting Gi: 193624826
Created: 24-Sep-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 31 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:based on the structure of human CDK2 bound with ATP and substrate peptide, and on the structures of other CDKs with bound ATP or ATP analogs
  • Citation:PMID 8756328

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                           ####    #             # #                #             #     
3BLH_A         7 DSVECPFCDEvsKYEKLAKIGQGTFGEVFKARHRk-tGQKVALKKVLMENEKEGFPITALREIKILQLLkHENVVNLIEI 85  human
Q9TVL3        72 DQATYPFIRDvsTYEKLNKIGQGTFGEVFKARCKn-tGRMVALKKILMENEKEGFPITALREVKMLEQLkHPNITDLIEV 150 nematode
CAZ36626      31 ELEGISKTKPvdQYVRLQKIGQGTFGEVFKVRHKs-tKQHFALKRIRMEQEKEGFPITALREIRILQSLnHENIVCLKEI 109 Schistosoma man...
XP_002131004   7 PNMDFPFCQDvlKYERITKIGQGTFGEVFKARDRk-tDRLVALKKVIMENEKEGFPITALREIKILQLLkHENVVDLIEI 85  Ciona intestinalis
Q4V862         6 DSVEFPYCDEvsKYERLAKIGQGTFGEVFKAKHRq-tGKKVALKKVLMENEKEGFPITALREIKILQLLkHENVVNLIEI 84  African clawed ...
XP_798269     35 ESPEFKYCEEvsKYDKLAKIGQGTFGEVFKAKHKk-nKNIVALKKVLMENEKEGFPITALREIRILQLLrHENVVPLYEI 113 purple urchin
XP_001948859  57 NQNQFWVKNIdkKYKLSSIIGQGSYGIVRKAQNIl-nQDIVAIKEILYLNRTEGFPITALREVRILQKLrHENIVRLIEV 135 pea aphid
AAM50669      37 EDYDFPYCDEsnKYEKVAKIGQGTFGEVFKAREKkgnKKFVAMKKVLMDNEKEGFPITALREIRILQLLkHENVVNLIEI 116 fruit fly
XP_001626865   4 DTLDFPYCHEvsKYERQAKIGQGTFGEVFKAKNRknpKEIVALKKVLMDNEKEGFPITALREIKILQLLnHENVVKLLEI 83  starlet sea ane...
XP_002109317   4 EPYNYPFIHDvgKYEKITKIGHGTFGEVFKARNRi-sKEFVALKRVLLGNEKEGFPITSLREIKILRALkHDNIVRLQEI 82  Trichoplax adha...
Feature 1                              ####  # ##                                    # # ## #    
3BLH_A        86 CRTKasp----ynrCKGSIYLVFDFCEHDLAGLLSnvlvkFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITrd 161 human
Q9TVL3       151 CSAKstgt--tgskDRATFYLVMALCAHDLAGLLSnpkirMSLVHIKTMMKHLMSGLNKLHRSKILHRDMKAANVLISkd 228 nematode
CAZ36626     110 CHSPpna----gngFKPQFYLVFEFCDHDLAGLSQqi--dFTEPVKKAIMKQLLTGVFYLHLNNVLHRDLKAANILIDkn 183 Schistosoma man...
XP_002131004  86 CRTKptq----ynrSKGSIYLVFEFCAHDLAGLLSnatvkFTLGEIKKTMLQLLEGLFYIHRNKILHRDMKAANILITkn 161 Ciona intestinalis
Q4V862        85 CRTKvsptanqynrCKGTIFLVFDFCEHDLAGLLSnahvkFTLSEIKKVMQMLLNGLYYIHRNKILHRDMKAANVLITrd 164 African clawed ...
XP_798269    114 CRTKata----ynrYKGSIYLVFEFCEHDLAGLLSntnvkFSLGEIKSVIKQLLNGLYYIHSNKVLHRDMKAANILITka 189 purple urchin
XP_001948859 136 CYNEakk----ennYRSTFYLILEFCEYDLARLLNykyvqFDLSEIKELIRQLLNGLYYMHTNKILHRDLKTSNILVTke 211 pea aphid
AAM50669     117 CRTKata----tngYRSTFYLVFDFCEHDLAGLLSnmnvkFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITkh 192 fruit fly
XP_001626865  84 CRTKaqp----fnrNKASIYLVFEFCEHDLAGLLNnqavkFSPPEMKKIMQMLLNALYFIHSNKILHRDMKAANILITkn 159 starlet sea ane...
XP_002109317  83 CRSKgtp----qsrKRGSIYLVFEFCAHDLAGLLQnpqvkFNLSEIKRMMKHLLSGLFYIHSNKVLHRDLKAANVLVTrd 158 Trichoplax adha...
Feature 1              #  #                 # #### #                                     ##      
3BLH_A       162 GVLKLADFGLARAFSLAKNSq--pNRYXNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQL 239 human
Q9TVL3       229 GILKLADFGLARPFVQRENGagprPLYTNRVVTLWYRPPELLLGDRQYGTKIDVWGAGCIMAEMWTRQPIMQGDTEQKQL 308 nematode
CAZ36626     184 GILKIADFGLARTTVASIRPdr-pTRYTGRVVTLWYRPPEILLNDRHYGKPVDMWGAGCIMAELWTKYPIMQGDNEISQL 262 Schistosoma man...
XP_002131004 162 GVLKLADFGLARAFSYTKTGq--aNRYTNRVVTLWYRPPELLLGDRDYGPPIDLWGAGCIMTEMWTRSPIMQGHTEQQQL 239 Ciona intestinalis
Q4V862       165 GVLKLADFGLARAFSLAKNSq--pNKYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQL 242 African clawed ...
XP_798269    190 GVLKLADFGLARAFSLPKGDa--pNRYTNRVVTLWYRPPELLLGERNYGPAIDLWGAGCIMAEMWTRSPIMQGNTEQHQL 267 purple urchin
XP_001948859 212 GILKIADFGLSRSFSIPTIDk--pNKYTNRVVTLWYRAPELLLGERNYGPAIDMWGAGCIMAEFWTRYPIMRGSSEAHQL 289 pea aphid
AAM50669     193 GILKLADFGLARAFSIPKNEs--kNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQL 270 fruit fly
XP_001626865 160 GVLKLAEFGLARAIHINKEQk---QRYTNRVVTLWYRPPELLLGERNYGPPIDLWGAGCIMAELWTRTPIMQGNTEQHQL 236 starlet sea ane...
XP_002109317 159 GVLKLADFGLARVYSRKEKT----HCFTNRVVTLWYRAPELLLGCRDYGPAIDMWAIGCIMAEFWTRSAIMQGNSETNQL 234 Trichoplax adha...
Feature 1                                                                                        
3BLH_A       240 ALISQLCGSITPEVWPnvdNYELYEk------LELVKGQKRKVK----------DRLKAyv------------------- 284 human
Q9TVL3       309 QLISGLCGSINKDVWPncvNMPLWSamssepnSALPQGKYRILPn--------kMKNLMkfdapdsktdpfgknvkqhds 380 nematode
CAZ36626     263 NLIINLCGSITPEIWPgveRLETFRe------ARLPQDIKRHVR----------EKLTPki------------------- 307 Schistosoma man...
XP_002131004 240 TLISQLCGSITKQVWPgveKYDLFTk------MELPTGQKRRVK----------ERLKAyv------------------- 284 Ciona intestinalis
Q4V862       243 TLISQLCGSITPEVWPnvdKYELYQk------LELPKGQKRKVK----------DRLKAyv------------------- 287 African clawed ...
XP_798269    268 TLISHLCGSITSAVWPgleKLELSNt------LELPKGHKRKVK----------DRLRSyv------------------- 312 purple urchin
XP_001948859 290 KCISFIRGKITPEVWPkvvNYDLYKn------MELPENYEFAETvkfltietlcLRLKPfnnylqew-------khimhr 356 pea aphid
AAM50669     271 TFISQLCGSFTPDVWPgveELELYKs------IELPKNQKRRVK----------ERLRPyv------------------- 315 fruit fly
XP_001626865 237 TLISHLCGSITPEVWPgvdKLELFDk------MVLPSGQKRRVK----------ERLRMyv------------------- 281 starlet sea ane...
XP_002109317 235 TLITQLCGSITPEVYPdvdKLDLFKk------FDLPASQKRRVK----------ERLSHyv------------------- 279 Trichoplax adha...
Feature 1                                         
3BLH_A       285 -rDPYALDLIDKLLVLDPAQRIDSDDALNHDFF 316 human
Q9TVL3       381 atDDDALHLLEILLAIDPDKRPTSDEAEDDIWF 413 nematode
CAZ36626     308 -sSLAAVDLIDQLLVLDPSKRLDAEQALSHDYF 339 Schistosoma mansoni
XP_002131004 285 -rDQYALDLIDKLLSLDPKHRIDSDEALNHDFF 316 Ciona intestinalis
Q4V862       288 -kDPHALDLIDKLLVLDPTQRLDSDDALNNDFF 319 African clawed frog
XP_798269    313 -kDQQALDLIDKLLNIDPKRRMDAAIALDHDFF 344 purple urchin
XP_001948859 357 isNVHGCDLLEKLLYLDPEKRCDANTALDHDFF 389 pea aphid
AAM50669     316 -kDQTGCDLLDKLLTLDPKKRIDADTALNHDFF 347 fruit fly
XP_001626865 282 -kDHNALDLIDKMLSLDPGPRIDADSALNHDYF 313 starlet sea anemone
XP_002109317 280 -rDRHALDLIDRCLTIDPAKRIDSDSALNHDFF 311 Trichoplax adhaerens

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap