3BLH,3BLQ


Conserved Protein Domain Family
STKc_CDK9

?
cd07865: STKc_CDK9 (this model, PSSM-Id:173754 is obsolete and has been replaced by 270848)
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9
Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multiple steps of gene expression including transcription elongation, mRNA synthesis, processing, export, and translation. It also plays a role in mediating cytokine induced transcription networks such as IL6-induced STAT3 signaling. In addition, the CDK9/cyclin T2a complex promotes muscle differentiation and enhances the function of some myogenic regulatory factors.
Statistics
?
PSSM-Id: 173754
View PSSM: cd07865
Aligned: 14 rows
Threshold Bit Score: 563.154
Threshold Setting Gi: 193624826
Created: 24-Sep-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 31 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:based on the structure of human CDK2 bound with ATP and substrate peptide, and on the structures of other CDKs with bound ATP or ATP analogs
  • Citation:PMID 8756328

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                           ####    #             # #                #             #     
3BLH_A         7 DSVECPFCDEvsKYEKLAKIGQGTFGEVFKARHRk-tGQKVALKKVLMENEKEGFPITALREIKILQLLkHENVVNLIEI 85
gi 75024614   72 DQATYPFIRDvsTYEKLNKIGQGTFGEVFKARCKn-tGRMVALKKILMENEKEGFPITALREVKMLEQLkHPNITDLIEV 150
gi 238665956  31 ELEGISKTKPvdQYVRLQKIGQGTFGEVFKVRHKs-tKQHFALKRIRMEQEKEGFPITALREIRILQSLnHENIVCLKEI 109
gi 198427109   7 PNMDFPFCQDvlKYERITKIGQGTFGEVFKARDRk-tDRLVALKKVIMENEKEGFPITALREIKILQLLkHENVVDLIEI 85
gi 82225932    6 DSVEFPYCDEvsKYERLAKIGQGTFGEVFKAKHRq-tGKKVALKKVLMENEKEGFPITALREIKILQLLkHENVVNLIEI 84
gi 72136390   35 ESPEFKYCEEvsKYDKLAKIGQGTFGEVFKAKHKk-nKNIVALKKVLMENEKEGFPITALREIRILQLLrHENVVPLYEI 113
gi 193624826  57 NQNQFWVKNIdkKYKLSSIIGQGSYGIVRKAQNIl-nQDIVAIKEILYLNRTEGFPITALREVRILQKLrHENIVRLIEV 135
gi 21429982   37 EDYDFPYCDEsnKYEKVAKIGQGTFGEVFKAREKkgnKKFVAMKKVLMDNEKEGFPITALREIRILQLLkHENVVNLIEI 116
gi 156365870   4 DTLDFPYCHEvsKYERQAKIGQGTFGEVFKAKNRknpKEIVALKKVLMDNEKEGFPITALREIKILQLLnHENVVKLLEI 83
gi 195998898   4 EPYNYPFIHDvgKYEKITKIGHGTFGEVFKARNRi-sKEFVALKRVLLGNEKEGFPITSLREIKILRALkHDNIVRLQEI 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                              ####  # ##                                    # # ## #    
3BLH_A        86 CRTKasp----ynrCKGSIYLVFDFCEHDLAGLLSnvlvkFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITrd 161
gi 75024614  151 CSAKstgt--tgskDRATFYLVMALCAHDLAGLLSnpkirMSLVHIKTMMKHLMSGLNKLHRSKILHRDMKAANVLISkd 228
gi 238665956 110 CHSPpna----gngFKPQFYLVFEFCDHDLAGLSQqi--dFTEPVKKAIMKQLLTGVFYLHLNNVLHRDLKAANILIDkn 183
gi 198427109  86 CRTKptq----ynrSKGSIYLVFEFCAHDLAGLLSnatvkFTLGEIKKTMLQLLEGLFYIHRNKILHRDMKAANILITkn 161
gi 82225932   85 CRTKvsptanqynrCKGTIFLVFDFCEHDLAGLLSnahvkFTLSEIKKVMQMLLNGLYYIHRNKILHRDMKAANVLITrd 164
gi 72136390  114 CRTKata----ynrYKGSIYLVFEFCEHDLAGLLSntnvkFSLGEIKSVIKQLLNGLYYIHSNKVLHRDMKAANILITka 189
gi 193624826 136 CYNEakk----ennYRSTFYLILEFCEYDLARLLNykyvqFDLSEIKELIRQLLNGLYYMHTNKILHRDLKTSNILVTke 211
gi 21429982  117 CRTKata----tngYRSTFYLVFDFCEHDLAGLLSnmnvkFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITkh 192
gi 156365870  84 CRTKaqp----fnrNKASIYLVFEFCEHDLAGLLNnqavkFSPPEMKKIMQMLLNALYFIHSNKILHRDMKAANILITkn 159
gi 195998898  83 CRSKgtp----qsrKRGSIYLVFEFCAHDLAGLLQnpqvkFNLSEIKRMMKHLLSGLFYIHSNKVLHRDLKAANVLVTrd 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              #  #                 # #### #                                     ##      
3BLH_A       162 GVLKLADFGLARAFSLAKNSq--pNRYXNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQL 239
gi 75024614  229 GILKLADFGLARPFVQRENGagprPLYTNRVVTLWYRPPELLLGDRQYGTKIDVWGAGCIMAEMWTRQPIMQGDTEQKQL 308
gi 238665956 184 GILKIADFGLARTTVASIRPdr-pTRYTGRVVTLWYRPPEILLNDRHYGKPVDMWGAGCIMAELWTKYPIMQGDNEISQL 262
gi 198427109 162 GVLKLADFGLARAFSYTKTGq--aNRYTNRVVTLWYRPPELLLGDRDYGPPIDLWGAGCIMTEMWTRSPIMQGHTEQQQL 239
gi 82225932  165 GVLKLADFGLARAFSLAKNSq--pNKYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQL 242
gi 72136390  190 GVLKLADFGLARAFSLPKGDa--pNRYTNRVVTLWYRPPELLLGERNYGPAIDLWGAGCIMAEMWTRSPIMQGNTEQHQL 267
gi 193624826 212 GILKIADFGLSRSFSIPTIDk--pNKYTNRVVTLWYRAPELLLGERNYGPAIDMWGAGCIMAEFWTRYPIMRGSSEAHQL 289
gi 21429982  193 GILKLADFGLARAFSIPKNEs--kNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQL 270
gi 156365870 160 GVLKLAEFGLARAIHINKEQk---QRYTNRVVTLWYRPPELLLGERNYGPPIDLWGAGCIMAELWTRTPIMQGNTEQHQL 236
gi 195998898 159 GVLKLADFGLARVYSRKEKT----HCFTNRVVTLWYRAPELLLGCRDYGPAIDMWAIGCIMAEFWTRSAIMQGNSETNQL 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
3BLH_A       240 ALISQLCGSITPEVWPnvdNYELYEk------LELVKGQKRKVK----------DRLKAyv------------------- 284
gi 75024614  309 QLISGLCGSINKDVWPncvNMPLWSamssepnSALPQGKYRILPn--------kMKNLMkfdapdsktdpfgknvkqhds 380
gi 238665956 263 NLIINLCGSITPEIWPgveRLETFRe------ARLPQDIKRHVR----------EKLTPki------------------- 307
gi 198427109 240 TLISQLCGSITKQVWPgveKYDLFTk------MELPTGQKRRVK----------ERLKAyv------------------- 284
gi 82225932  243 TLISQLCGSITPEVWPnvdKYELYQk------LELPKGQKRKVK----------DRLKAyv------------------- 287
gi 72136390  268 TLISHLCGSITSAVWPgleKLELSNt------LELPKGHKRKVK----------DRLRSyv------------------- 312
gi 193624826 290 KCISFIRGKITPEVWPkvvNYDLYKn------MELPENYEFAETvkfltietlcLRLKPfnnylqew-------khimhr 356
gi 21429982  271 TFISQLCGSFTPDVWPgveELELYKs------IELPKNQKRRVK----------ERLRPyv------------------- 315
gi 156365870 237 TLISHLCGSITPEVWPgvdKLELFDk------MVLPSGQKRRVK----------ERLRMyv------------------- 281
gi 195998898 235 TLITQLCGSITPEVYPdvdKLDLFKk------FDLPASQKRRVK----------ERLSHyv------------------- 279
                        330       340       350
                 ....*....|....*....|....*....|...
Feature 1                                         
3BLH_A       285 -rDPYALDLIDKLLVLDPAQRIDSDDALNHDFF 316
gi 75024614  381 atDDDALHLLEILLAIDPDKRPTSDEAEDDIWF 413
gi 238665956 308 -sSLAAVDLIDQLLVLDPSKRLDAEQALSHDYF 339
gi 198427109 285 -rDQYALDLIDKLLSLDPKHRIDSDEALNHDFF 316
gi 82225932  288 -kDPHALDLIDKLLVLDPTQRLDSDDALNNDFF 319
gi 72136390  313 -kDQQALDLIDKLLNIDPKRRMDAAIALDHDFF 344
gi 193624826 357 isNVHGCDLLEKLLYLDPEKRCDANTALDHDFF 389
gi 21429982  316 -kDQTGCDLLDKLLTLDPKKRIDADTALNHDFF 347
gi 156365870 282 -kDHNALDLIDKMLSLDPGPRIDADSALNHDYF 313
gi 195998898 280 -rDRHALDLIDRCLTIDPAKRIDSDSALNHDFF 311

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap