1QMZ,2IW8,1W98,1H27,2JGZ,1JST,1PW2


Conserved Protein Domain Family
STKc_CDK2_3

?
cd07860: STKc_CDK2_3 (this model, PSSM-Id:173751 is obsolete and has been replaced by 270844)
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3
Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex plays a role in regulating DNA replication. CDK2, together with CDK4, also regulates embryonic cell proliferation. Despite these important roles, mice deleted for the cdk2 gene are viable and normal except for being sterile. This may be due to compensation provided by CDK1 (also called Cdc2), which can also bind cyclin E and drive the G1 to S phase transition. CDK3 is regulated by cyclin C and it phosphorylates pRB specifically during the G0/G1 transition. This phosphorylation is required for cells to exit G0 efficiently and enter the G1 phase.
Statistics
?
PSSM-Id: 173751
View PSSM: cd07860
Aligned: 15 rows
Threshold Bit Score: 581.765
Threshold Setting Gi: 221130719
Created: 24-Sep-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 31 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Structure:1QMZ_A; Human CDK2 binds MgATP and substrate p107 peptide; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1               ####    #            # #                #             #               ###
1QMZ_A         4 NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEF 83  human
2JGZ_A         4 NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEF 83  human
1JST_A         3 NFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEF 82  human
P23437         3 NFQKVEKIGEGTYGVVYKARNRETGEIVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEF 82  African clawed ...
AAH62836       3 SFQKVEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLRDVIHTENKLYLVFEF 82  zebrafish
NP_001075175   3 NFQKVEKIGEGTYGVVYKARNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEF 82  chicken
EAW89353      31 MFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKHPNIVRLLDVVHNERKLYLVFEF 110 human
XP_001633466   3 NFEKVEKIGEGTYGVVYKARDKTTGRMVALKKIRLDTESEGVPSTAIREISLLKELNHPNVVSLLDVVHNQKSLYLVFEF 82  starlet sea ane...
CAA12223       3 NFEKIEKIGEGTYGVVYKAKDLKSGKTVALKKIRLDTESEGVPSTAIREIALLKELDHKNIVKLHDVVHSDKKLYLVFEF 82  purple sea urchin
XP_002189906  32 SFQKVEKIGEGTYGVVYKARNKRTGQLVALKKIRLDAESEGVPSTAIREISLLKELKHPNIVRLLDVIHSQKKLYMVFEY 111 zebra finch
Feature 1        #  # ##                                     # # ## #          #  #           # #
1QMZ_A        84 LHQDLKKFMDASalTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYXHE 163 human
2JGZ_A        84 LHQDLKKFMDASalTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYXHE 163 human
1JST_A        83 LHQDLKKFMDASalTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYXHE 162 human
P23437        83 LNQDLKKFMDGSniSGISLALVKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINSDGAIKLADFGLARAFGVPVRTFTHE 162 African clawed ...
AAH62836      83 LHQDLKRFMDSTsvSGISLPLVKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINAQGEIKLADFGLARAFGVPVRTYTHE 162 zebrafish
NP_001075175  83 LHQDLKKFMDASslGGIALPLIKSYLFQLLQGLAFCHAHRVLHRDLKPQNLLINADGAIKLADFGLARAFGVPVRTYTHE 162 chicken
EAW89353     111 LSQDLKKYMDSTpgSELPLHLIKSYLFQLLQGVSFCHSHRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHE 190 human
XP_001633466  83 LSQDLKKYMDCLppSGISTSLIKSYVYQLLSGVAYCHSHRVLHRDLKPQNLLIDKNGAIKLADFGLARAFGVPVRSYTHE 162 starlet sea ane...
CAA12223      83 MNQDLKKYMDIAppSGLPTALVKSYLQQLLHGIAFCHAHRVLHRDLKPQNLLIDADGHIKLADFGLARAFGVPVRTYTHE 162 purple sea urchin
XP_002189906 112 LNQDLKKYMDSCqaGELPLSLVKNYLFQLLQGVSFCHSHRVIHRDLKPQNLLINEAGAIKLADFGLARAFGVPLRTYTHE 191 zebra finch
Feature 1        ### #                                     ##                                    
1QMZ_A       164 VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPK 243 human
2JGZ_A       164 VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPK 243 human
1JST_A       163 VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPK 242 human
P23437       163 VVTLWYRAPEILLGCKFYSTAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVSWPGVTTMPDYKSTFPK 242 African clawed ...
AAH62836     163 VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDESIWPGVTSMPDYKPSFPK 242 zebrafish
NP_001075175 163 VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEAAWPGVTALPDYKPSFPK 242 chicken
EAW89353     191 VVTLWYRAPEILLGSKFYTTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPK 270 human
XP_001633466 163 VVTLWYRAPEILLGSRYYATPVDVWSIGCIFAEMKTRRALFPGDSEIDQLFRIFRTLGTPDDKVWPGVSELPDYKTSFPK 242 starlet sea ane...
CAA12223     163 VVTLWYRAPEILLGCRFYSTAVDIWSIGCIFVEMITRRALFPGDSEIDQLFRIFRTMGTPDEKLWPGVTSLPDYKTSFPR 242 purple sea urchin
XP_002189906 192 VVTLWYRAPEILLGCRYYSTPVDIWSIGCIFAEMMTRKALFPGDSEIDQLFQIFRTLGTPTEVTWPGVTQLPDYKGSFPR 271 zebra finch
Feature 1                                                    
1QMZ_A       244 WARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFF 287 human
2JGZ_A       244 WARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFF 287 human
1JST_A       243 WARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFF 286 human
P23437       243 WIRQDFSKVVPPLDEDGRDLLAQMLQYDSNKRISAKVALTHPFF 286 African clawed frog
AAH62836     243 WARQDLSKVVPPLDEDGRDLLGQMLTYDPNKRISAKNALVHRFF 286 zebrafish
NP_001075175 243 WARQDLGKVVPPLDEEGRKLLAQMLHYDPNKRISAKAALSHPFF 286 chicken
EAW89353     271 WTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYF 314 human
XP_001633466 243 WPVQSIRHVLPTLDNTAIDLLQKMLTYQPNARISAKAALSHEFF 286 starlet sea anemone
CAA12223     243 WSPQDFNKIVPMLSKDGKDLLKCMLCYEPDKRISAKTALSHPYF 286 purple sea urchin
XP_002189906 272 WPRKEMKDIVPNLDRDGRDLLTQLLLYDPSKRISAKAALNHQYF 315 zebra finch

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap