Conserved Protein Domain Family
STKc_MAPK15

?
cd07852: STKc_MAPK15 (this model, PSSM-Id:173747 is obsolete and has been replaced by 270841)
Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15
Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimuli whereas ERK8 shows low basal activity and is activated by DNA-damaging agents. ERK7 and ERK8 also have different substrate profiles. Genome analysis shows that they are orthologs with similar gene structures. ERK7 and ERK 8 may be involved in the signaling of some nuclear receptor transcription factors. ERK7 regulates hormone-dependent degradation of estrogen receptor alpha while ERK8 down-regulates the transcriptional co-activation androgen and glucocorticoid receptors.
Statistics
?
PSSM-Id: 173747
Aligned: 31 rows
Threshold Bit Score: 551.411
Threshold Setting Gi: 2131000
Created: 18-Jul-2006
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   #### ## #            # #                #              #          
Q8TD08      5 VDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTgEVVAIKKIFDAFRDKTDAQRTFREITLLQEFgDHPNIISLLDVIRAEN 84  human
2131000     6 IDGEVEQRYRILRHIGSGAYGVVWCALDRRTgKCVALKKVYDAFGNVQDAQRTYREVMLLQRLrHNPFIVGILDVIRAAN 85  Leishmania mexicana
310969      6 IDGRIEQRYKILCHIGSGAYGVVWCALDRVTkMKVAIKKVYDAFGNRQDAQRTYREVMLLSTL-QLDNIVPLLNVIRSIN 84  Trypanosoma brucei
Q11179      5 VDTHIHEKFDLQKRLGKGAYGIVWKAYDKRSrETVALKKIFDAFRNPTDSQRTFREVMFLQEFgKHPNVIKLYNIFRADN 84  nematode
NP_727335  17 LDQTVESIFDVRKRMGKGAYGIVWKATDRRTkNTVALKKVFDAFRDETDAQRTYREVIFLRAFrCHPNIVRLVDIFKASN 96  fruit fly
CAH03215   10 VEDHILRRFDLQEYKGKGAYGIVWKAYDTKTkQIVALKKVFDAFQNSTDAQRTYREVVFLKQLnNHDNIVKLISVIRADN 89  Paramecium tetraur...
EAY20298   11 IDKHILSRYEIVNKIGKGAYGVVWKAMDKVThQMVALKKIFGAFRNSTDAQRTFREITFLRQLrGHPHIVDLLAVYKAVN 90  Trichomonas vagina...
CAK75260    5 IDSNILKKYEIMTKIGKGAYGVVWKARDIKSqRIVALKKVFDAFSNPTDAQRTYREVSFLKQL-NHPNIIQLIDTYPAEN 83  Paramecium tetraur...
XP_973435  11 IDEHISRRFDIQKRLGKGAYGIVWKAIDRKTkDVVAVKKIFDAFRNQTDAQRTFREIMFLQSLkNHPNIVKLFSIHRAAN 90  red flour beetle
CAZ29922    6 VEPVILKNYTIERRIGKGAYGIVWKAVNKKThKKLALKKIFDAFRNQTDAQRTFREISFLQQFsNHPNIIRLLNVIKAEN 85  Schistosoma mansoni
Feature 1            ####  # ##                                   # # ## #         ##  #      
Q8TD08     85 DRDIYLVFEFMDTDLNAVIRKGgLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGD 164 human
2131000    86 DIDLYLVFELIETDLTAIIRKN-LLQRDHKRFLTYQLLRTVAQLHAQNIIHRDLKPANVFVSSDCSIKLGDFGLARTFRS 164 Leishmania mexicana
310969     85 GTDLYLVFELAETDLSVVLRHN-IMESVQRQYVAYQIVYAVAGLHARGVIHRDLKPANVFLNSDCNIKLGDFGLARCFNT 163 Trypanosoma brucei
Q11179     85 DRDIYLAFEFMEADLHNVIKKGsILKDVHKQYIMCQLFRAIRFLHSGNVLHRDLKPSNVLLDADCRVKLADFGLARSLSS 164 nematode
NP_727335  97 NLDFYLVFEFMESDLHNVIKRGnVLKDVHKRFVMYQLINAIKFIHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSS 176 fruit fly
CAH03215   90 NKDLYMVFEYMETDLHRVIRAE-LLNNMHIQYVMYQILKCLKYIHSGQLVHRDLKPANILINADCHIKVADFGLSRCLSE 168 Paramecium tetraur...
EAY20298   91 NLDLYVVFELLESDVHSVIRAN-ILMDVHKRFIVWQVLVALKYLHSRRLIHRDLKPSNLLINSDSKVKLCDFGLARTFSE 169 Trichomonas vagina...
CAK75260   84 QNDLYLIFEYMETDLHIAIRAK-ILQPLHRRYIIYQLFKALKYIHSSGMIHRDLKPANILLDSECKIKLADFGLARMVCT 162 Paramecium tetraur...
XP_973435  91 NSDIYLGFEYMETDLHNVIKKG-ILKDVHKKYVMYQLLKAVKYIHSGNVIHRDLKPSNILLDVMCRCKIADFGLARSLYQ 169 red flour beetle
CAZ29922   86 DKDIYLVFEYMETDLNNCIKKGnILRDVHKKFIFYQLLRAVKYIHSGNVIHRDLKPSNILLNSDCLVKLCDFGLTRSLTN 165 Schistosoma mansoni
Feature 1                             # #### #                                     #          
Q8TD08    165 LPegp--------------edqAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELI 230 human
2131000   165 GYdneq-------------eflDLTDYIATRWYRSPEILVKSRAYSTAMDMWAIGCVIGEMLLGRPLFEGRNTLDQLRLI 231 Leishmania mexicana
310969    164 QGgd-----------------nDLTEYIATRWYRSPEVLVKSTCYTTAMDMWAVGCILGELFTGSPLFTGNSTLHQIGLI 226 Trypanosoma brucei
Q11179    165 LEdypeg-----------qkmpDLTEYVATRWYRSPEILLAAKRYTKGVDMWSLGCILAEMLIGRALFPGSSTINQIERI 233 nematode
NP_727335 177 RRiyddl-----------eqdgMLTDYVATRWYRAPEILVASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVNQIEKI 245 fruit fly
CAH03215  169 TEnnn--------------eipIMTEYVATRWYRAPEILFGSHYYSTAVDMWSVGCILGEMILGKACFAGTSTLDQIDKI 234 Paramecium tetraur...
EAY20298  170 GDic----------------qsVMTYYVSTRWYRSPELIIGSNHYNEGVDMWAVGCIVAELYAGRPLFPGTSTLDQMERV 233 Trichomonas vagina...
CAK75260  163 LEq------------------dILTDYVATRWFRAPEILLGSKSYSFGVDMWSIGCMIGEMILGKALFSGTSTINQLEKI 224 Paramecium tetraur...
XP_973435 170 SSdsln------------etdpTLTDYVATRWYRAPEILIANRRYTKGIDMWSLGCILGEITAGKPLFPGSSTVNQVEKI 237 red flour beetle
CAZ29922  166 TLenrttsmesfidgdddyenpVLTEYVATRWYRAPEILLASNRYTKYVDIWSLGCILGEMLLGKALFPGTSTINQIERI 245 Schistosoma mansoni
Feature 1                                                                                     
Q8TD08    231 LETIPPPSEEDLLALg-sGCRASVLh-QLGSRPRQTLDALLPpdtSPEALDLLRRLLVFAPDKRLSATQALQHPYVqRFH 308 human
2131000   232 IEAIGVPSDADVRSLh-sPELEKLIn-SLPTPLIFSPLVGNKnlkDSEATDLMMKLIVFNPKRRLSAVEALQHPYVaPFV 309 Leishmania mexicana
310969    227 VAALGEPSAEDLESLk-sEETWPLId-SLPAIDPDPLPERLSk-yNADAVDLICKCIVFDPNKRPTAREALQHPYFaPFT 303 Trypanosoma brucei
Q11179    234 MNTIAKPSRADIASIg-sHYAASVLe-KMPQRPRKPLDLIITq-sQTAAIDMVQRLLIFAPQKRLTVEQCLVHPYVvQFH 310 nematode
NP_727335 246 VTSLPNVTKLDIASIg-pSFGSVLLsrNIQRDRRYSLDEMMKn-cCDDGISLVKALLVLNPHNRLTAKEAIRHPYVsRFQ 323 fruit fly
CAH03215  235 IQLIGKPTLSDLESIn-aPMGYQIIe-QMDSKKQFSYHQFFPk-aNDLQIDFIKKLLVYNPKKRLTAEQALDHPYLkDFK 311 Paramecium tetraur...
EAY20298  234 VSLTGPPSAADIASMh-sEFAETMIanLSYSQPRMTLPQKLPm-aDADTIDFISKLLVFNPTQRMNVEQCLNHPYVaQFH 311 Trichomonas vagina...
CAK75260  225 IEVLGMPTPEEIQSL---GGQNQLFd-KYPRNYKSNLKSILNc--DDDELDLIKKLLVFDPNKRICVQDALRHPYLkEFY 298 Paramecium tetraur...
XP_973435 238 MASIPTPSQEDISQVcvsGVGISMIk-NAASSEKVPLITLLGknaCRSSISLINKLLVFNPNKRLTAEEALEHDYVsQFH 316 red flour beetle
CAZ29922  246 ISVMERPTIQDIECLh-sDYGRSVLd-KALQKPYRPLRTLFSnniDEQALNLLENMIRLNPEKRFTVEQALNHSYVeDFR 323 Schistosoma mansoni
Feature 1                                          
Q8TD08    309 CPSDEWAr--eADVRPRAHEGvqLSVPEYRSRVYQMI 343 human
2131000   310 QHGELEKiqglDPLVLPLVDEkiYTKEEYKANLYDEI 346 Leishmania mexicana
310969    304 SPSDFEEldkaVPIKLPFPDEeeRPADQYRSALYDII 340 Trypanosoma brucei
Q11179    311 NPSEEPVl--nYEVYPPLPDHiqLSIDDYRDRLYEMI 345 nematode
NP_727335 324 YASAEMDl--hMDVVPPLKDHvrYDVDQYRNSLYELI 358 fruit fly
CAH03215  312 QTEPEILl--dQYITIPFNDNkkLKLQDYRDALYKGL 346 Paramecium tetraurelia
EAY20298  312 NTEEEAAs--tEPIKLALSDNkrYTVKDYRNKLYKEM 346 Trichomonas vaginalis G3
CAK75260  299 NPKEEITf--kGQLILKLQDDkqYPVSSYRDLLYKQN 333 Paramecium tetraurelia
XP_973435 317 NPDEEIVl--pHDIVIPFNDDvrLSVEDYRNKLYEIM 351 red flour beetle
CAZ29922  324 DPSSEIVl--kHPVTPILRDDkqLSVSDYRQKLYEII 358 Schistosoma mansoni

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap