Conserved Protein Domain Family
STKc_CDKL1_4

?
cd07847: STKc_CDKL1_4 (this model, PSSM-Id:173744 is obsolete and has been replaced by 270837)
Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4
Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The function of CDKL4 is unknown.
Statistics
?
PSSM-Id: 173744
Aligned: 14 rows
Threshold Bit Score: 561.222
Threshold Setting Gi: 42601424
Created: 24-Sep-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:based on the structure of human CDK2 bound with ATP and substrate peptide, and on the structures of other CDKs or MAPKs, bound with ATP or ATP analogs
  • Citation:PMID 9739089

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                ####    #            # #                #             #               ##
Q00532         2 EKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFE 81  human
XP_787618      2 DKYERLGKIGEGSYGVVFKCRHKDTGTIVAIKRFVESEDDPLIKKIALREIRMLKQLKHENLVNLKEVFRRKKKLHLVFE 81  purple urchin
ABE73272       2 DRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFE 81  fruit fly
CAB63367       2 DKYDRLSKLGEGSYGVVYKCKNRDTGQIVAIKKFVETEDDPHIKKIALREIRMLKQLKHQNLVGLIEVFKRNRKLHLVFE 81  nematode
XP_001641563   2 ERFEKLGKIGEGSYGVVFKCRHKETGQIVAIKKFVESEDDPLIKKIAMREVKMLKQLKHPNLVNLLEVFKRKRKLHLVFE 81  starlet sea ane...
XP_002108655   2 EKYEKICKIGEGSYGHVYKCRNRENGQVVAIKKFVESEDDPLIKKIAFREVKMLRLLKHPNLVNLLEVFRRKRKLHLVFE 81  Trichoplax adha...
EAX00349       2 EKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFE 81  human
XP_001743460   2 EKYEKLSKIGEGSYGIVIKCRHKESGRIVAIKKFLETEDDPQIRKIALREVRMLKMLKHGNLVNLHEVFRRKRRLHLVFE 81  Monosiga brevic...
CAZ33986      68 EKYEKICKIGEGAYGVVFKCRDIKSGQLVAIKQFTASEEDPVIRKIAMREIRMLKRLKHPNLVNLIEVFRKKKRLNLVFQ 147 Schistosoma man...
CAZ28060       9 DRYEKLTRIGEGAYGVVFKCRHRDTGDIVAIKKFTDSEEDPVIHRIAMREIRTLKQLKHPNLINLIEVFKRKRRLHLVFQ 88  Schistosoma man...
Feature 1        ##  # ##                                          # # ## #          #  #        
Q00532        82 YCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHK------HNCIHRDVKPENILITKHSVIKLCDFGFARLLAGPS 155 human
XP_787618     82 YCDYTVLNTLEANVNGVPEGQGMNIVYQTLEAVNFCHQ------HNCIHRDVKPENILITKDGRIKLCDFGFARILTGPD 155 purple urchin
ABE73272      82 FCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHK------QGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGE 155 fruit fly
CAB63367      82 LCDRTVLHELEKNPHGVNDELIKKIIYQLLEALKFCHS------HKCIHRDVKPENIFLTRNDQVKLGDFGFARIINTTE 155 nematode
XP_001641563  82 YCDQTVLNVLDKHPNGVNEDTVKNIIYQTLKAVDFCHS------HNCIHRDVKPENILITKNYIIKLCDFGFARLISRYP 155 starlet sea ane...
XP_002108655  82 YCEYTVLNELDAHPKGVDELVVKKIIWQTLQAVNFCHK------HNCIHRDVKPENILITKTGVIKLCDFGFARVLNPGD 155 Trichoplax adha...
EAX00349      82 YCDHTLLNELERNPNGMDSDSIVGRLRSVADRSRLAPKnnqimiLQCIHRDIKPENILITKQGIIKICDFGFAQILIPGD 161 human
XP_001743460  82 FLDHSLLDELDANPKGLDEVQIKKVTFQILKGLEFCHA------NNVIHRDVKPENILISRENIVKLCDFGFARTVSGQG 155 Monosiga brevic...
CAZ33986     148 FIDNSLLNEMEQRPRKLDKGKIRKITWQILLATDFCHQ------SNCIHRDIKPENILINKANEVKLCDFGFARFLTGPG 221 Schistosoma man...
CAZ28060      89 YVDHTLLHELEKHTKGLDRLQIRKLTYQLLQAVNFCHA------HNCIHRDVKPENILITKSGQLKLCDFGFARLLTGPG 162 Schistosoma man...
Feature 1            # #### #                                     #                              
Q00532       156 d-YYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIP--RHQQVFSTN 232 human
XP_787618    156 d-EYTDYVATRWYRAPELLVGDMVYGPPVDVWAIGCVTAELIAGEALWPGRSDVDQLYLIKQTLGKLEFrsKHSKIFSTN 234 purple urchin
ABE73272     156 --NYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLP--RHIQIFGQN 231 fruit fly
CAB63367     156 --MYTDYVATRWYRSPELLVGDVQYGPPVDIWAVGCVYAELLTGEALWPGRSDIDQLYHIRKTLGEFLP--RHISIFRTN 231 nematode
XP_001641563 156 geDYTDYVATRWYRAPELLVGDTAYGPPVDVWAIGCVFAELLVGQPLWPGRSDVDQLYLIKKTLGNLIP--RHIQIFSQN 233 starlet sea ane...
XP_002108655 156 --DYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAELLTGQALWPGRSDVDQLYLVRRTLGDLIP--RHMQIFSNN 231 Trichoplax adha...
EAX00349     162 --AYTDYVATRWYRAPELLVGDTQYGSSVDIWAIGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIP--RHQSIFKSN 237 human
XP_001743460 156 a-AYTEYVATRWYRAPELLVGDTQYGAPVDVFATGCVVAEMLTGQPLWPGKSDIDQLYHIIQTFGKLCP--RHEQVFSSN 232 Monosiga brevic...
CAZ33986     222 g-EYTDYVATRWYRSPELLVGDTQYGPPVDIWAIGCVFAEMLLGCPLWPGSSDLDQLYLITKNLGDLYP--RHRQIFEQS 298 Schistosoma man...
CAZ28060     163 d-EYTDYVATRWYRAPELLVGDTQYGTPVDIWAIGCVVAEMLTSLPLWPGRSDLDQLHLITQTLGDLVP--RHREIFEKN 239 Schistosoma man...
Feature 1                                                                      
Q00532       233 QYFSGvKIPDPEDMEP--LELKFPNi-----SYPALGLLKGCLHMDPTQRLTCEQLLHHPYF 287 human
XP_787618    235 HFFKGmSIPEPERRIP--LKDKVRNl-----NSTALTFLEACLQMDPADRLSCQELMEMPFF 289 purple urchin
ABE73272     232 EYFKGiTLPVPPTLEP--LEDKMPAks--qqNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYF 289 fruit fly
CAB63367     232 QFFFGlSIPEPEHLEP--LPSKLPNa-----SSAQLDFLQKCFEMSPDRRFSCSELMLHGIF 286 nematode
XP_001641563 234 HFFRGlQIPEPTTREP--LEMKYSHi-----STDALSFMKGCLVMEPNDRLTCEELLDHKYF 288 starlet sea anemone
XP_002108655 232 QYFKGlSIPVPETTEP--LEQKFIKh-----SNVAINFMRDCLQLDPASRSSCRQLLDHSYF 286 Trichoplax adhaerens
EAX00349     238 GFFHGiSIPEPEDMET--LEEKFSDv-----HPVALNFMKGCLKMNPDDRLTCSQLLESSYF 292 human
XP_001743460 233 DYFKGlKLPEASPSKMlpLASRFRAy-----SSPAVKFLQKTMAPSPTERCTCTEALNHEYF 289 Monosiga brevicollis MX1
CAZ33986     299 KYFAGiQVPSSTSVEP--LEKRFEKtypltlSPRELDFLQACVRMDPSERWSCAELLKHPYF 358 Schistosoma mansoni
CAZ28060     240 CFFKGyKLIVPENRKD--LSEKFTSlqp-piTSKELNFLQSCLSMDPTERLNSESLLKHPYM 298 Schistosoma mansoni

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap