1QMZ,2IW8,1W98,1H27,2JGZ,1JST,1PW2


Conserved Protein Domain Family
STKc_CDK1_like

?
cd07835: STKc_CDK1_like (this model, PSSM-Id:173738 is obsolete and has been replaced by 270829)
Click on image for an interactive view with Cn3D
Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases
Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2 phase entry and progression while the CDK1/cyclin B complex is critical for G2 to M phase transition. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex plays a role in regulating DNA replication. Studies in knockout mice revealed that CDK1 can compensate for the loss of the cdk2 gene as it can also bind cyclin E and drive G1 to S phase transition. CDK3 is regulated by cyclin C and it phosphorylates pRB specifically during the G0/G1 transition. This phosphorylation is required for cells to exit G0 efficiently and enter the G1 phase.
Statistics
?
PSSM-Id: 173738
View PSSM: cd07835
Aligned: 24 rows
Threshold Bit Score: 546.143
Threshold Setting Gi: 17738075
Created: 24-Jul-2009
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 31 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Structure:1QMZ_A; Human CDK2 binds MgATP and substrate p107 peptide; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              ####    #               # #                #             #                
1QMZ_A         5 FQKVEKIGEGTYGVVYKARNKl---tGEVVALKKIRLDtetEGVPSTAIREISLLKELNHPNIVKLLDVIHte-nKLYLV 80
gi 17738075    8 FQRAEKIGEGTYGIVYKARSNs---tGQDVALKKIRLEgetEGVPSTAIREISLLKNLKHPNVVQLFDVVIsg-nNLYMI 83
gi 115923      4 YEKVEKIGEGTYGVVYKALDKa---tNETIALKKIRLEqedEGVPSTAIREISLLKEMNHGNIVRLHDVVHse-kRIYLV 79
gi 461706     10 YQKLEKLGEGTYGKVYKAKEKa---tGRMVALKKIRLEd--DGVPSTALREISLLKEVPHPNVVSLFDVLHcq-nRLYLV 83
gi 196013348   4 FHKLEKIGEGTYGKVYKACNKi---tGQTVALKKIRLDsdkEGVPSTTLREISILRSLNHSFVVRLYDVVHsd-qCLYLV 79
gi 115915      8 YKRLEKVGEGTYGVVYKALDLrpgqgQRVVALKKIRLEsedEGVPSTAIREISLLKELKDDNIVRLYDIVHsdahKLYLV 87
gi 454980      4 YEKVEKIGEGTYGVVYKARDRl---tNETIALKKIRLEqedEGVPSTAIREISLLKEMQHGNIVRLQDVVHse-kRLYLV 79
gi 159481134   4 YEKLERAGEGTYGVVFKARDRy---tNEIVALKKIRLEqedEGVPSTAIREISFLKELRHDNVVRLYDVLYsd-rRLYLV 79
gi 55977990    4 YEKVAKIGEGTYGVVYKAKSLr---dDAMVALKRIRLDqddEGVPSTAIREISLLKELRHENVVSLLEVIHee-tKLYLV 79
gi 226515093  26 FEKVEKIGEGTYGVVYKARDRr---dDSVVALKRIRLDqeeEGVPSTAIREISLLKELKHENIVSLMDVIHqd-kKLYLV 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        ####  # ##                                      # # ## #           #  #         
1QMZ_A        81 FEFLHQDLKKFMDAsal-tgIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINt-eGAIKLADFGLARAFGVPVR 158
gi 17738075   84 FEYLNMDLKKLMDKkk--dvFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQNLLVDt-aGKIKLADFGLARAFNVPMR 160
gi 115923     80 FEYLDLDLKKFMDScpe-faKNPTLIKSYLYQILHGVAYCHSHRVLHRDLKPQNLLIDrrtNALKLADFGLARAFGIPVR 158
gi 461706     84 FEYLDQDLKKYMDSvp---aLCPQLIKSYLYQLLKGLAYSHGHRILHRDLKPQNLLIDr-qGALKLADFGLARAVSIPVR 159
gi 196013348  80 FEYLDHDLKHYLDHay---kIPPALLKSYLYQMLRAISYCHSRRVLHRDLKPQNLLIDs-tGTLKLADFGLARIFGLPVR 155
gi 115915     88 FEFLDLDLKRYMEGipkdqpLGADIVKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINk-dGNLKLGDFGLARAFGVPLR 166
gi 454980     80 FEYLDLDLKKHMDScpe-laKDPRLIKTFLYQILRGIAYCHSHRVLHRDLKPQNLLIDrktNALKLADFGLARAFGIPVR 158
gi 159481134  80 FEFLDLDLKKQMDQtpn-fsRNQRVIKMYMWQMLSGIAFCHSRRILHRDLKPQNLLIDrsrNTLKLADFGLARAFGIPVR 158
gi 55977990   80 FEYLDLDLKKHMDSsph-isNDRMVIKGYVYQICAGIAFCHSHRVLHRDLKPQNLLIDttnNVLKLADFGLARAFGIPVR 158
gi 226515093 102 FEFLDVDLKKHLDThph-vsNDRRVIKGYLYQMCAGIAYCHSHRVLHRDLKPQNLLVDqttNVLKLADFGLARAFGIPLR 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          # #### #                                     ##                               
1QMZ_A       159 TYXHEVVTLWYRAPEILLGckyYSTAVDIWSLGCIFAEMVTrRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVtsmPDYK 238
gi 17738075  161 AYTHEVVTLWYRAPEILLGtkfYSTGVDIWSLGCIFSEMIMrRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVtqlPDFK 240
gi 115923    159 TFTHEVVTLWYRAPEILLGarqYSTPVDVWSVGCIFAEMVNqKPLFPGDSEIDELFKIFRILGTPNEQSWPGVsclPDFK 238
gi 461706    160 VYTHEIVTLWYRAPEVLLGsksYSVPVDMWSVGCIFGEMLNkKPLFSGDCEIDQIFRIFRVLGTPDDSIWPGVtklPEYV 239
gi 196013348 156 QYTHEVITLWYRAPEILLGstyYSTPVDIWSIGCIFVEMINrRPLFAGDSEIDQLFRVFRTLGTPDEITWPGVsemSDYK 235
gi 115915    167 AYTHEIVTLWYRAPEVLLGgkqYSTGVDTWSIGCIFAEMCNrKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIvylPDFK 246
gi 454980    159 TFTHEVVTLWYRAPEILLGsrhYSTPVDVWSVGCIFAEMVNqRPLFPGDSEIDELFKIFRVLGTPNEETWPGVtslPDFK 238
gi 159481134 159 AYTHEVVTLWYRAPEILLGsktYSTPVDIWSIGCIFAEMVNhRPLFPGDSEIDQLHKIFQLLGTPDEAMWAGCsalPDFK 238
gi 55977990  159 AYTHEVVTLWYRAPEILLGvrtYSTPVDVWSIGCIMAEMVNhAPLFPGDSEIDELFKIFKTLGTPGETLWPEAkqlPDYQ 238
gi 226515093 181 AYTHEVVTLWYRSPEILLGarhYSTPVDVWSIGCIFAEMINhAPLFPGDSEIDELFRIFRVLGTPDDGAWQGVeqlPDYK 260
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*....
Feature 1                                                         
1QMZ_A       239 PSFPKWARQDFSKVVPPldEDGRSLLSQMLHYDPNKRISAKAALAHPFF 287
gi 17738075  241 TKFPRWEGTNMPQPITE--HEAHELIMSMLCYDPNLRISAKDALQHAYF 287
gi 115923    239 TAFPRWQAQDLATVVPNldPAGLDLLSKMLRYEPSKRITARQALEHEYF 287
gi 461706    240 STFPNWPGQPYNKIFPRcePLALDLIAKMLQYEPSKRISAKEALLHPYF 288
gi 196013348 236 STFPKWPSRDLNSVIYShdEDCVDLIKQMLVYEPNGRISARLALQHPYF 284
gi 115915    247 PSFPQWRRKDLSQVVPSldPRGIDLLDKLLAYDPINRISARRAAIHPYF 295
gi 454980    239 SAFPKWPAKDLATVVPGlePAGIDLLSKMLCLEPSKRITARSALEHEYF 287
gi 159481134 239 DTFPKWRPQNLGAAVPTlsPEGVDLLARMLVYTPQHRITASAAMEHAYF 287
gi 55977990  239 EGFPKWKAKPWESLCPAldEAGVDLLRSLLQYSPEKRISAKYATQHRWF 287
gi 226515093 261 TQFPQWRAKEWKDICPSldEAGLDLLEQMLQYAPHKRISARDACNHRFF 309

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap