1F3M,2C30,2F57,1YHV,2Q0N,2CDZ


Conserved Protein Domain Family
STKc_PAK

?
cd06614: STKc_PAK (this model, PSSM-Id:173728 is obsolete and has been replaced by 270789)
Click on image for an interactive view with Cn3D
Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase
Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding site for PIX (PAK-interacting exchange factor). Group II PAKs contain a PBD and a catalytic domain, but lack other motifs found in group I PAKs. Since group II PAKs do not contain an obvious AID, they may be regulated differently from group I PAKs. Group I PAKs interact with the SH3 containing proteins Nck, Grb2 and PIX; no such binding has been demonstrated for group II PAKs.
Statistics
?
PSSM-Id: 173728
Aligned: 28 rows
Threshold Bit Score: 404.286
Created: 18-Jul-2006
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 36 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:The active site is composed of the ATP binding site and the substrate binding site. The substrate binding site is based on the binding of human PAK4 to a consensus peptide.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                #####   #            # #                              
1F3M_C       2 DEEILEKLRSIVsvGDPKKKYTRFEKIGQGASGTVYTAMDvatGQEVAIRQMNLQqqp------kkELIINEILVMRENk 75   human
2CDZ_A      13 HEQFRAALQLVVdpGDPRSYLDNFIKIGEGSTGIVCIATVrssGKLVAVKKMDLRkqq------rrELLFNEVVIMRDYq 86   human
XP_657512  172 EDVEKVQLKDVTieQDPREFYSDFEKIGEGASGEVFSAKRkadGIVVALKQMEVNnd-------neKLIATEISLMKGCk 244  Entamoeba histol...
XP_761161 1351 PAKLSHLRDAIQlqALRKDVLCNLQMIGDGESGPVFAAHDvvkKRRVAIKVVRFAsdrdeepsarlLGLGKEVGIWRRCr 1430 Ustilago maydis 521
XP_657576  184 ENETTITLKDIVqpGNPTELFDNWQQIGEGVSGVVFQCVDkktKEERAVKKIKIEd---------dSINLQEIKIMQTLk 254  Entamoeba histol...
XP_656447  111 PDEKEVDLKSFInkNDPDEIYENLEKIGEGGVGDVFRATRkvdGCEVALKRMRITkk-------skRAIVTEVTILNQYr 183  Entamoeba histol...
EAY22235   141 SADVLPPLEEVIkyQDPRPLLQNMQVIAEGSTCIIYTAIYn--GIEVAVKEMHLNek-------keKYLLDETRLMYTMk 211  Trichomonas vagi...
XP_653898  129 EKESDLTLEDLAeeGLPEDFYENFSKIGEGAAGEVFVAQNkqtGKDMALKKCIITsk-------neKSLINEIEIMKNCk 201  Entamoeba histol...
XP_651523  178 ENDVPVVLKELItsGDPTVLYKDYVPIGEGMSGVVFHCYEtstNKEVAMKKILIKn---------dSVNIQEIKIMQTLn 248  Entamoeba histol...
XP_656956   83 GKEEEDDITQYTtaADPDENYENLAKTIYGDEDEYMATRKs-dGMEVSLRRMRITkk-------tkRAVVREVVVLSKCv 154  Entamoeba histol...
Feature 1          #                 ##### ##  #                                      # #### # 
1F3M_C      76 NPNIVNYLDSYLVG--DELWVVMEYLAgGSLTDVVTet----cmDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILL 149  human
2CDZ_A      87 HENVVEMYNSYLVG--DELWVVMEFLEgGALTDIVTht----rmNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILL 160  human
XP_657512  245 HDNVVTFYEAFYLPakKLMWMSMEYMDgGCLTDILEnhdi-iemTEPQIAYVCRETLRALNFIHGLHCIHRDIKSDNMLL 323  Entamoeba histol...
XP_761161 1431 HVNVLDLYSTVLTN--EAIWMVHELAE-RSLADVIAwkdagvdlNESRMSRIMGDLVEALQFLHAKRVLHRDVRSDNVMI 1507 Ustilago maydis 521
XP_657576  255 HPNIVGFFGCFELD--NYLYISMEFMDrNNLTAILEffps-vamNEPQIAYVARETNEALRYVHSFHRIHRDIKSDNILI 331  Entamoeba histol...
XP_656447  184 HENVVTYIECYLIN--EMLWLVMEYMDgGCLTDIIDrhke-vplTEHFISFICTETLKALTYLHSFHCVHRDIKSDNLLL 260  Entamoeba histol...
EAY22235   212 DEHIIRFYDAYKDG--NTLWIIMEYMDaGALTYVARyc----dcMEPHIAYIAREILLALKYIHSQNKIHRDIKTDNVLL 285  Trichomonas vagi...
XP_653898  202 HPNIVSFFGSYLEE--GYVWVVMEFMDsGCLTEVLTeyengfkmTEPQMAYVLREVMKGLLYLHQRHKIHRDIKSDNILI 279  Entamoeba histol...
XP_651523  249 QRNIVGYLGCYELD--NYLYIAMEYMDrNNLTAMLDffpe-fslSERHIAYVVHESNTALKYLHSLHRIHRDIKSDNILL 325  Entamoeba histol...
XP_656956  155 NDNIVKYVECYLIN--DMLWLVTELMDaGELTNAIDlhpt-lpmKECHIAYVCKRVLQGLVYLHKMGIIHRDIKSDNILL 231  Entamoeba histol...
Feature 1              ##  #            ##### #                          #        ###          
1F3M_C     150 GmDGSVKLTDFGFCAQITPEqskrSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIA 229  human
2CDZ_A     161 ThDGRVKLSDFGFCAQVSKEvprrKXLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIR 240  human
XP_657512  324 TnDGHVKLADFGYAAQLNQKqknrNTVVGTPYWMAPELIRGHDYGVKIDIWSLGIMVMEMAEGDPPYMEFPPLRALFLIT 403  Entamoeba histol...
XP_761161 1508 SsTGVCKLGDFTHAGELSAGvstrHSVVGTPYWMAPEVIKAHKYDMRCDVWSLGVVLWEMIEGDPPRVEFPPLRAITLTA 1587 Ustilago maydis 521
XP_657576  332 NhNGEVKLADFGVSVQLTKNkskrNTIVGTPYWMAPEVIKGKDYNCLIDVWSLGIMCREMMEGYPPYMDDPPLRALFQIS 411  Entamoeba histol...
XP_656447  261 KkDGSIKLSDFGYAAQLTKQksnrTSIVGTPYWMAPELIRSQRYDEKVDIWSLGIMCMEMADGNPPYMDYPPMRALFLIT 340  Entamoeba histol...
EAY22235   286 SqKGHVKLADFGYAAQLTTAaerrNSMVGTPFWMAPELIQRTPYSFAVDIWSLGILCRELAEGEPPYVDEPPMRATFLIV 365  Trichomonas vagi...
XP_653898  280 SsDGSVKIGDFGYAAQLTSQrdkrNSIVGTPYWMAPEVIRNKLYDAKADIWSIGIMIMEMTEGDPPYMELPPLRALFLIT 359  Entamoeba histol...
XP_651523  326 NhRGEIKLADFGISVQLTKRkskrNTVVGTPYWMAPEVIKGKDYGTNIDIWSLGIMCREMMEGVPPYIDDPPLRALFKIS 405  Entamoeba histol...
XP_656956  232 HhKGTVKLSNFGFAAILTSAhpnrNSIVGTPFWMAPELIKSQNYDTKVDIWSLGITCREMADGTPPYMDFPPMKALFQIT 311  Entamoeba histol...
Feature 1                                                               
1F3M_C     230 TNGTPELQNPekLSAIFRDFLNRCLDMdVEKRGSAKELLQHQFLKiaKPLSSLTPLI 286  human
2CDZ_A     241 DNLPPRLKNLhkVSPSLKGFLDRLLVRdPAQRATAAELLKHPFLAkaGPPASIVPLM 297  human
XP_657512  404 TKGIPPLKNAekWSRDMNGFVARCLETiPDNRADSEELLQHPFMKiaCENTDFAQLI 460  Entamoeba histolytica HM-1:IMSS
XP_761161 1588 TLGLPALRHAasLSHELKSFLHWATEMdAEKRPSAEMLAMSDFLAdpCSRASMVAML 1644 Ustilago maydis 521
XP_657576  412 TKGVPPITTGs-WSKELLDYVNGCLSVnPDQRPSTESSVKNPFFQkaCTKIEFADFV 467  Entamoeba histolytica HM-1:IMSS
XP_656447  341 TKGIPPLKDKekWSTLFNTFVSDCLVLnPQLRKTSFEMIKHPFLEtkVSKSEMADLI 397  Entamoeba histolytica HM-1:IMSS
EAY22235   366 IKGIPEISDKesRSPELLDFLDKCLRKdPKLRPTAEELLNHPFLKcaCDQKYIPPLI 422  Trichomonas vaginalis G3
XP_653898  360 TKGIPPLKERdsWSPDLVKLVESCLMKdPNQRPTSEQILESPFIAtaCKKEEFARVV 416  Entamoeba histolytica HM-1:IMSS
XP_651523  406 TKGIPPVQYGd-YTPTILDFVDKCLTFdPTKRPDCEELDKDPFMSlaCSREEFAEFI 461  Entamoeba histolytica HM-1:IMSS
XP_656956  312 TKGIPPLEGI--WDDKFKNFLNKCLNPdASKRASAEELLQDPFISmeCTEEEFIDFL 366  Entamoeba histolytica HM-1:IMSS

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap