Conserved Protein Domain Family
STKc_Rim15_like

?
cd05611: STKc_Rim15_like (this model, PSSM-Id:173702 is obsolete and has been replaced by 270762)
Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases
Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a downstream effector of PKA and regulates entry into stationary phase (G0). Thus, it plays a crucial role in regulating yeast proliferation, differentiation, and aging. Cek1 may facilitate progression of mitotic anaphase.
Statistics
?
PSSM-Id: 173702
View PSSM: cd05611
Aligned: 5 rows
Threshold Bit Score: 420.735
Threshold Setting Gi: 1170646
Created: 6-Nov-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the binding of peptide substrates and ATP analogs to the AGC kinases, PKA and PKB.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         #####   #            # #                                #               ## # 
P43565     797 LKPISKGAYGSVYLARKKltGDYFAIKVLRKSDMiaknqvTNVKSERAIMMVQsdKPYVARLFASFQNkdNLFLVMEYLp 876  baker's yeast
P38938     592 LKPISKGAFGSVYLAQKRttGDYFAIKILKKSNMiaknqvINVRAERAILMSQgeSPFVAKLYYTFQSkdYLYLVMEYLn 671  Schizosaccharomy...
CAA22178   531 LKEINRGAYGRVYLAKKRssGKYFALKMIPKSSLdslkkiKGLLLEKRNMHIQryGPNTVKLYYAFDSgdYLCLVMDYFn 610  fission yeast
AAW42041  1215 LKPISRGAFGSVYLAKKVatGDYFAIKALKKSDMisknqiTNVKAERTILMNQasSPYVAKLFFSFQSkdYLYLVMEYLn 1294 Cryptococcus neo...
CAK42389   741 IKPISKGAFGSVYLAKKKvtGEYFAIKVLKKADMvaknqvTNVKAERAIMMWQgeSDFVAKLYWTFSSkdYLYLVMEYLn 820  Aspergillus niger
Feature 1        # #                                    # # ## #         ##  #                 
P43565     877 GGDLATLIKMmgyLPDQWAKQYLTEIVVGVNDMHQNGIIHHDLKPENLLIDnaGHVKLTDFGLSRAGLIrrhkfvphkss 956  baker's yeast
P38938     672 GGDCGSLLKTmgvLDLDWIRTYIAETVLCLGDLHDRGIIHRDIKPENLLISqnGHLKLTDFGLSRVGYMkrhrrkqsssi 751  Schizosaccharomy...
CAA22178   611 GGDCETLIQKlgpLPEQWVCQYAAELLNAIELLHQDGIIHHDIKPANMLVDetGHIRLTDFGLSENVEEkkevykltkrm 690  fission yeast
AAW42041  1295 GGDCASLVKTlggLSEDWARNYTAEVVLGLEYLHKRNIVHRDIKPDNLLIDarGHLKLTDFGLSRIGLLnrqvggprpay 1374 Cryptococcus neo...
CAK42389   821 GGDCASLVKVlggLPEDWAKKYIAEVVLGVEHLHGRGIVHRDLKPDNLLIDqtGHLKLTDFGLSRMGLVgrqkrvlksmn 900  Aspergillus niger
Feature 1                                                                                      
P43565     957 lsisstlpidnpannftmnnnnsnhsqlstpdsftsdhkqynrskksslgqqyehseysstsnshsmtptpstntvvyps 1036 baker's yeast
P38938     752 pvldlrdrssaisdlslstassvleaqslitperpkrpslneklls---------------------------------- 797  Schizosaccharomy...
CAA22178   691 sfeqkhgnlyeqlqpkkfefvryvrnyrgnidelek-------------------------------------------- 726  fission yeast
AAW42041  1375 lrgislrgsgqhrlsmtrttsnsslidsnmlspeissgqslp-------------------------------------- 1416 Cryptococcus neo...
CAK42389   901 nepapdllkqgsfpratsitssrsasfdfqgsgspgstplitpdvassipqpsyfslnqggglsrqtsrrasgyrsdsg- 979  Aspergillus niger
Feature 1                                                                                      
P43565    1037 yyrgkdrshgssnidlpaslrrsesqlsfslldisrsstpplanptnsnannimrrksltenksfsndllssdaiaatnt 1116 baker's yeast
P38938     798 ---------------------------------------------------ldgtsirlagqsfnyensaedsptatntp 826  Schizosaccharomy...
CAA22178   727 ------------------------------------------------------------aespqqnsdyandsvqhlld 746  fission yeast
AAW42041  1417 -------------------------------------------------------nvsqsyfsqmrpsgpedessgsesa 1441 Cryptococcus neo...
CAK42389   980 ------------------aseslnamfrtlsineggeasgtmpvpvpssgqhqhqhhlpeeesqseagesphlyplqptm 1041 Aspergillus niger
Feature 1                                    ######                           #     #  #       
P43565    1117 ninsnnnislspapsdlalfypddskqNKKFFGTPDYLAPETIEGkgednKQCDWWSVGCIFFELLLGYPPFHAEtpDAV 1196 baker's yeast
P38938     827 tsqvdesnifrstdsprvqpffenkdpSKRFIGTPDYIAPEVILGnp-giKASDWWSLGCVVFEFLFGYPPFNAEtpDQV 905  Schizosaccharomy...
CAA22178   747 fdinnmdetaihmlmnqlekkenrtfiKKDISGTPNYMAPEILMGvd--tQMGDIWAMGCVIFEMLTGTRPFEANtvKAI 824  fission yeast
AAW42041  1442 giipkhvrqmatklsselgtpsvngkePPKFVGTPDYLAPESILGigqddAAVDWWALGVVLYEFLYGFPPFHAEtpEKV 1521 Cryptococcus neo...
CAK42389  1042 snsfsystppqqsmmpplmalfdpedhNRRFVGTPDYLAPETINGvg-qdEMSDWWSLGCIMFEFLFGYPPFNAGtpDEV 1120 Aspergillus niger
Feature 1                                                                             
P43565    1197 FKKILsgVIQWPEfkneeeerefltPEAKDLIEKLLVvdPAKRLGAKgi-------qEIKDHPYFKNVDWD 1260 baker's yeast
P38938     906 FQNILarRINWPAevft-----aesSVALDLIDRLLCmnPANRLGANgv-------eEIKAHPFFKSVNWD 964  Schizosaccharomyces pombe
CAA22178   825 WARIErnDIGWTKrvke-----scsKEAVDLITKLMDpdCNKRLGSNgy-------qEIKKHPFFRTIKWD 883  fission yeast
AAW42041  1522 FDNVVsrRINWHEdev------gisPEARDLINRLLCsdPQMRLGANga-------eEVKSHPYFASINWD 1579 Cryptococcus neoformans v...
CAK42389  1121 FDNILhrRINWPDeaee-----fasPEAIDLVNRLMTmnPRERIGANvdekypnggaEIRSHPWFSDINWD 1186 Aspergillus niger

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap