Conserved Protein Domain Family
STKc_NDR_like

?
cd05599: STKc_NDR_like (this model, PSSM-Id:173690 is obsolete and has been replaced by 270750)
Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases
Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplication. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. This subfamily also contains fungal NDR-like kinases.
Statistics
?
PSSM-Id: 173690
View PSSM: cd05599
Aligned: 11 rows
Threshold Bit Score: 653.664
Threshold Setting Gi: 124413361
Created: 24-Aug-2006
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the binding of peptide substrates and ATP analogs to the AGC kinases, PKA and PKB.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                 #####   #            # #                                    #           
gi 56749668    88 DDFESLKVIGRGAFGEVRLVQKKDtgHIYAMKILRKSDMLekEQVAHIRAERDILVEAd-----GAWVVKMFYSFQDkrN 162
gi 9716484     91 EDFEALKVIGRGAFGEVRLVQKKDtgHVYAMKVLRKADMLekEQVAHVRAERDVLVEAd-----HQWVVKMYYSFQDpvN 165
gi 7506647     78 NDFESLKVIGRGAFGEVRLVQKHDtgHIYAMKILRKSEMVekEQTAHVRAERDILSEAd-----CDWVVKMYYSFQDysN 152
gi 115901678   81 DDFESIKVIGRGAFGEVRLVQKKDtgHIYAMKILRKCDMHekEQVAHVRAERDILVEAd-----NPWVVKMYYSFQDpyN 155
gi 6005814     87 EDFESLKVIGRGAFGEVRLVQKKDtgHVYAMKILRKADMLekEQVGHIRAERDILVEAd-----SLWVVKMFYSFQDklN 161
gi 124413361   86 KDFEPIEIIGRGAFGEVRLCRNKLsnDIVAVKKMKKSEMLykNQVCHVRAERDLLAASd-----NAWIVQLKCSFQDekY 160
gi 52782721   124 NDFHTVKVIGKGAFGEVRLVQKIDtgKIYAMKTLLKSEMFkkDQLAHVKAERDVLAESd-----SPWVVSLYYSFQDsqY 198
gi 22331282   118 DDFEPLTMIGKGAFGEVRICREKTtgNVYAMKKLKKSEMLrrGQVEHVKAERNLLAEVd-----SNCIVKLYCSFQDeeY 192
gi 66816743   110 SDFEVIRIIGRGAFGEVSLVRHREsnDLYAMKRLKKSEMLkkEQAAHVRAERDVLASAn-----TNWVVKLYYSFQDdnY 184
gi 67462805    88 SDFETIKVIGRGGFGEVRLVVKKNsnSLFAMKMMRKKDMIerGQTGHVKAERDILAQThf---tNDWVVKLYYSFQDndY 164
gi 66805697   128 HSFESIRIIGRGAFGEVRLVKMKKnnKFFAMKKLDKSKMIekHQTIHVRSERDILADSnnihgsNPWIVSLYYSFQDanF 207
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             ## #   # #                                    # # ## #                      
gi 56749668   163 LYLIMEFLpGGDMMTLLMKkdTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDa------------------- 223
gi 9716484    166 LYLIMEFLpGGDMMTLLMKkdTLSEEGTQFYISETALAIDSIHKLGFIHRDIKPDNLLLDa------------------- 226
gi 7506647    153 LYLVMEFLpGGDMMTLLIKkdTLTEEATQFYIAEAALAIQFIHSLGFIHRDIKPDNLLLDa------------------- 213
gi 115901678  156 LYLIMEFLpGGDMMTLLMKreTLSEEVTLFYIAETIMAINSIHKLNFIHRDIKPDNLLLDarkrekrtqhaqketeflrl 235
gi 6005814    162 LYLIMEFLpGGDMMTLLMKkdTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDs------------------- 222
gi 124413361  161 LYLVMEYLpGGDLMTLLMKkdIFTEKESQFYMAESIMAVDSVHKLKYIHRDLKPDNILLQa------------------- 221
gi 52782721   199 LYLIMEFLpGGDLMTMLIKydTFSEDVTRFYIAECILAIEAVHKLGFIHRDIKPDNILIDk------------------- 259
gi 22331282   193 LYLIMEYLpGGDMMTLLMRkdTLTEDEARFYVGETVLAIESIHKHNYIHRDIKPDNLLLDr------------------- 253
gi 66816743   185 LYLIMEYLpGGDMMSLLIKydIFTENQARFYIAETILAIESVHTLGYIHRDIKPDNLLLDs------------------- 245
gi 67462805   165 LYLMMEYLaGGDMMTLLIRenIFSHEMARFYIAELLLAIDSIHQLNYIHRDIKPDNILFDn------------------- 225
gi 66805697   208 LYLIMEYVpGGDMMTQLIKydTFTEDATRFYIAETVLALHSIHKLSYIHRDIKPDNLLIDq------------------- 268
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 56749668       --------------------------------------------------------------------------------
gi 9716484        --------------------------------------------------------------------------------
gi 7506647        --------------------------------------------------------------------------------
gi 115901678  236 krsrlgcddfesikvigrgafgevrlvqkkdtghiyamkilrkcdmhekeqvahvraerdilveadnpwvvkmyysfqdp 315
gi 6005814        --------------------------------------------------------------------------------
gi 124413361      --------------------------------------------------------------------------------
gi 52782721       --------------------------------------------------------------------------------
gi 22331282       --------------------------------------------------------------------------------
gi 66816743       --------------------------------------------------------------------------------
gi 67462805       --------------------------------------------------------------------------------
gi 66805697       --------------------------------------------------------------------------------
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                              ##  #      
gi 56749668   224 ---------------------------------------------------------------KGHVKLSDFGLCTGLKK 240
gi 9716484    227 ---------------------------------------------------------------RGHLKLSDFGLCTGLKK 243
gi 7506647    214 ---------------------------------------------------------------RGHVKLSDFGLCTGLKK 230
gi 115901678  316 ynlylimeflpggdmmtllmkretlseevtlfyiaetimainsihklnfihrdikpdnllldaRGHIKLSDFGLCTGLKK 395
gi 6005814    223 ---------------------------------------------------------------KGHVKLSDFGLCTGLKK 239
gi 124413361  222 ---------------------------------------------------------------DGHIKLSDFGLCKYVES 238
gi 52782721   260 ---------------------------------------------------------------TGHIKLSDFGLSMGFHK 276
gi 22331282   254 ---------------------------------------------------------------SGHMKLSDFGLCKPLDC 270
gi 66816743   246 ---------------------------------------------------------------KGHVKLCDLGLCTGFHR 262
gi 67462805   226 ---------------------------------------------------------------NGHIKLTDFGLCTGFHK 242
gi 66805697   269 ---------------------------------------------------------------KGHIKVSDFGLCTGLQT 285
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                               ######                    
gi 56749668   241 AHRTEFYRnlthnpps------------dfsfqnmnSKRKAETWKKNRRqLAYSTVGTPDYIAPEVFMQtgYNKLCDWWS 308
gi 9716484    244 SHRTDFYRdlsqakpsdfig-----tcaslscspmdSKRRAESWKRNRRaLAYSTVGTPDYIAPEVFLQtgYGPACDWWS 318
gi 7506647    231 FHRTDHYRnwpstlpp------------dfiskpfeSKRKAETWKRNRRaYAYSTVGTPDYIAPEVFQPngYTKSCDWWS 298
gi 115901678  396 SHRTEFYRdlsqvrpndf---------sattckpmdSKRLAESWKRNRRaLAYSTVGTPDYIAPEVFLQtgYSHVCDWWS 466
gi 6005814    240 AHRTEFYRnlnhslps------------dftfqnmnSKRKAETWKRNRRqLAFSTVGTPDYIAPEVFMQtgYNKLCDWWS 307
gi 124413361  239 RGTRLDERisih--------------------kpedKGGNTTTFKRNRI-KAYSTVGTPDYIAPEVFGKsgYNETADWWS 297
gi 52782721   277 THDNAYYQrlfeskintstsstqnslmvdtisltmsSKDKIATWKKNRRiMAYSTVGTPDYIAPEIFTQhgYGQECDWWS 356
gi 22331282   271 SILQEKDFvvahnlsgalqs----dgrpvaprrtrsQMEQLQNWQRNRRmLAYSTVGTPDYIAPEVLLKkgYGMECDWWS 346
gi 66816743   263 LHSSEFYQmlvgdamtik--------mklieatpltQTERIASWKKARRaLAYSAVGTPDYTAPEVFLQigYNKEVDWWS 334
gi 67462805   243 DHESSYFEivdkaskln----------lsdlksqklSKELAHNYKNKKRnLAYSVVGTPDYTAPEVFLQkgYYKECDYWS 312
gi 66805697   286 NRVPTLAEiykkyegdnn--------ireedqtpqsRSARFDSWKRQRRvLAYSNVGTPDYTAPEVLMKdgYSAECDWWS 357
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1               #     #  #                                                                
gi 56749668   309 LGVIMYEMLIGYPPFCSEtPQETYRKVMNWKETLVFPPEv-----pISEKAKDLILRFCIdSENRIGn-sGVEEIKGHPF 382
gi 9716484    319 LGVIMYEMLMGYPPFCSDnPQDTYRKVMNWRETLIFPPEi-----pISEEAKETIINFCCeADRRLGsqrGLEDLKSVPF 393
gi 7506647    299 LGVIMYEMLIGYPPFCSElPQETYRKVINWQQTLVFPSDv-----pISIEAKATIKRFCCeAERRLGnhgGLDEIKQCPF 373
gi 115901678  467 LGVVMYEMLIGYPPFCSEtPQETYRKVMHWRETLQFPAEi-----pISNEAKGMIQRFCCeADRRVGk-nGVDEIKSHAF 540
gi 6005814    308 LGVIMYEMLIGYPPFCSEtPQETYKKVMNWKETLTFPPEv-----pISEKAKDLILRFCCeWEHRIGa-pGVEEIKSNSF 381
gi 124413361  298 LGAILFEMLVGYPPFFSDdPSSTCQKIINWKKTLVIPQEa-----kLSPAATDLILRLMTdASNRLGv-nGVNEIKAHPF 371
gi 52782721   357 LGAIMFECLIGWPPFCSEnAHETYRKIINWRENLYFPEDl-----hLSAEAEDLIRKLLTsADQRLGr-yGANDIKLHPF 430
gi 22331282   347 LGAIMYEMLVGFPPFYSDePMTTCRKIVNWKNYLKFPDEv-----rLSPEAKDLICRLLCnVEQRIGt-kGANEIKEHPW 420
gi 66816743   335 LGVILYEMVVGHPPFLSDnTTETCLKILNCKETLQIPTDm-----gLSKEVIDLIKRLVC-EKDRYK---SADEIKLHPF 405
gi 67462805   313 VGCILFEMLAGYPPFVSDdSVQTCLKIINCNETLQFPDDv-----eIHDDAKDLIKKLVClKEKRLA---DIKLIQQHPF 384
gi 66805697   358 VGVIMFEMLVGYPPFCSEsIRETYHKIMNWKQTLPKIMEeakaevnLSPEAQDLIERFLTdPMTRIGf-nGVEEIQSHPF 436
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 56749668   383 FEGVDWEHirERPAAIPIEIKSIDDTSNFDDFPEsdilqpvpn--------------------------------ttepd 430
gi 9716484    394 FRGVDWEHirERPAAIPVEVRSIDDTSNFDEFPDvsleipsap--------------------------------ipqgg 441
gi 7506647    374 VKRIDWNHirERPPPIRVTVKSIDDTSNFDDFPDedltwptst-------------------------------lirpee 422
gi 115901678  541 FHGVDWEHirERPAAIPTNIKSFEDTSNFDAFPEielkpitp---------------------------------pqatg 587
gi 6005814    382 FEGVDWEHirERPAAISIEIKSIDDTSNFDEFPEsdilkptvat-----------------------------snhpetd 432
gi 124413361  372 FAGIDWKNlrSKVSPYIPEIKSELDTRNFDKFEEqepwvpq-----------------------------------dsgk 416
gi 52782721   431 FRGVNWDTirEINAPFIPQLKSITDTSYFEEIDTipnitmnsppv----------------------------lqnkips 482
gi 22331282   421 FSGVEWEKlyQMKAAFIPQVNDELDTQNFEKFEEtdkqvpktpk-----------------------------sgpwrkm 471
gi 66816743   406 FKGVNWDNirNQSAPFVPELKSPTDTSNFDIYEEipndiddddnnnnnnsnnninlndninsnctyttptkksnimgkgn 485
gi 67462805   385 FKGFNWDTifEQTPPYLPKLKSPFDTSNFDDFELneddveek----------------------------------pvni 430
gi 66805697   437 FKGVDWRRlrETRPPIIPQLSSPTDTSNFDHYEEeqqpepmqpv-----------------------------qsksrrk 487
                         570
                  ....*....|....*..
Feature 1                          
gi 56749668   431 yksKDWVFLNYTYKRFE 447
gi 9716484    442 eiaKDWVFINYTYKRFE 458
gi 7506647    423 qpgRRGEFVDFTYKRFD 439
gi 115901678  588 ehmKDWVFINYTFKRFE 604
gi 6005814    433 yknKDWVFINYTYKRFE 449
gi 124413361  417 svrKDVNFIGYTFNREV 433
gi 52782721   483 dvdQNLAFVGYTYKRFD 499
gi 22331282   472 lssKDINFVGYTYKNVE 488
gi 66816743   486 ikdKDLAFIGFTFKGFD 502
gi 67462805   431 nnpKDLAFVGYTYKGFL 447
gi 66805697   488 itsFDIPFIGYTYRNFD 504

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap