Conserved Protein Domain Family
STKc_NDR_like

?
cd05599: STKc_NDR_like (this model, PSSM-Id:173690 is obsolete and has been replaced by 270750)
Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases
Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplication. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. This subfamily also contains fungal NDR-like kinases.
Statistics
?
PSSM-Id: 173690
Aligned: 11 rows
Threshold Bit Score: 653.664
Created: 24-Aug-2006
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the binding of peptide substrates and ATP analogs to the AGC kinases, PKA and PKB.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              #####   #            # #                                    #           
Q9Y2H1      88 DDFESLKVIGRGAFGEVRLVQKKDtgHIYAMKILRKSDMLekEQVAHIRAERDILVEAd-----GAWVVKMFYSFQDkrN 162  human
AAF97511    91 EDFEALKVIGRGAFGEVRLVQKKDtgHVYAMKVLRKADMLekEQVAHVRAERDVLVEAd-----HQWVVKMYYSFQDpvN 165  fruit fly
T16718      78 NDFESLKVIGRGAFGEVRLVQKHDtgHIYAMKILRKSEMVekEQTAHVRAERDILSEAd-----CDWVVKMYYSFQDysN 152  nematode
XP_787948   81 DDFESIKVIGRGAFGEVRLVQKKDtgHIYAMKILRKCDMHekEQVAHVRAERDILVEAd-----NPWVVKMYYSFQDpyN 155  purple urchin
NP_009202   87 EDFESLKVIGRGAFGEVRLVQKKDtgHVYAMKILRKADMLekEQVGHIRAERDILVEAd-----SLWVVKMFYSFQDklN 161  human
CAK78498    86 KDFEPIEIIGRGAFGEVRLCRNKLsnDIVAVKKMKKSEMLykNQVCHVRAERDLLAASd-----NAWIVQLKCSFQDekY 160  Paramecium tetra...
Q6TGC6     124 NDFHTVKVIGKGAFGEVRLVQKIDtgKIYAMKTLLKSEMFkkDQLAHVKAERDVLAESd-----SPWVVSLYYSFQDsqY 198  Pneumocystis car...
NP_188973  118 DDFEPLTMIGKGAFGEVRICREKTtgNVYAMKKLKKSEMLrrGQVEHVKAERNLLAEVd-----SNCIVKLYCSFQDeeY 192  thale cress
XP_642376  110 SDFEVIRIIGRGAFGEVSLVRHREsnDLYAMKRLKKSEMLkkEQAAHVRAERDVLASAn-----TNWVVKLYYSFQDdnY 184  Dictyostelium di...
XP_648064   88 SDFETIKVIGRGGFGEVRLVVKKNsnSLFAMKMMRKKDMIerGQTGHVKAERDILAQThf---tNDWVVKLYYSFQDndY 164  Entamoeba histol...
XP_636570  128 HSFESIRIIGRGAFGEVRLVKMKKnnKFFAMKKLDKSKMIekHQTIHVRSERDILADSnnihgsNPWIVSLYYSFQDanF 207  Dictyostelium di...
Feature 1          ## #   # #                                    # # ## #                      
Q9Y2H1     163 LYLIMEFLpGGDMMTLLMKkdTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDa------------------- 223  human
AAF97511   166 LYLIMEFLpGGDMMTLLMKkdTLSEEGTQFYISETALAIDSIHKLGFIHRDIKPDNLLLDa------------------- 226  fruit fly
T16718     153 LYLVMEFLpGGDMMTLLIKkdTLTEEATQFYIAEAALAIQFIHSLGFIHRDIKPDNLLLDa------------------- 213  nematode
XP_787948  156 LYLIMEFLpGGDMMTLLMKreTLSEEVTLFYIAETIMAINSIHKLNFIHRDIKPDNLLLDarkrekrtqhaqketeflrl 235  purple urchin
NP_009202  162 LYLIMEFLpGGDMMTLLMKkdTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDs------------------- 222  human
CAK78498   161 LYLVMEYLpGGDLMTLLMKkdIFTEKESQFYMAESIMAVDSVHKLKYIHRDLKPDNILLQa------------------- 221  Paramecium tetra...
Q6TGC6     199 LYLIMEFLpGGDLMTMLIKydTFSEDVTRFYIAECILAIEAVHKLGFIHRDIKPDNILIDk------------------- 259  Pneumocystis car...
NP_188973  193 LYLIMEYLpGGDMMTLLMRkdTLTEDEARFYVGETVLAIESIHKHNYIHRDIKPDNLLLDr------------------- 253  thale cress
XP_642376  185 LYLIMEYLpGGDMMSLLIKydIFTENQARFYIAETILAIESVHTLGYIHRDIKPDNLLLDs------------------- 245  Dictyostelium di...
XP_648064  165 LYLMMEYLaGGDMMTLLIRenIFSHEMARFYIAELLLAIDSIHQLNYIHRDIKPDNILFDn------------------- 225  Entamoeba histol...
XP_636570  208 LYLIMEYVpGGDMMTQLIKydTFTEDATRFYIAETVLALHSIHKLSYIHRDIKPDNLLIDq------------------- 268  Dictyostelium di...
Feature 1                                                                                      
Q9Y2H1         --------------------------------------------------------------------------------      human
AAF97511       --------------------------------------------------------------------------------      fruit fly
T16718         --------------------------------------------------------------------------------      nematode
XP_787948  236 krsrlgcddfesikvigrgafgevrlvqkkdtghiyamkilrkcdmhekeqvahvraerdilveadnpwvvkmyysfqdp 315  purple urchin
NP_009202      --------------------------------------------------------------------------------      human
CAK78498       --------------------------------------------------------------------------------      Paramecium tetra...
Q6TGC6         --------------------------------------------------------------------------------      Pneumocystis car...
NP_188973      --------------------------------------------------------------------------------      thale cress
XP_642376      --------------------------------------------------------------------------------      Dictyostelium di...
XP_648064      --------------------------------------------------------------------------------      Entamoeba histol...
XP_636570      --------------------------------------------------------------------------------      Dictyostelium di...
Feature 1                                                                           ##  #      
Q9Y2H1     224 ---------------------------------------------------------------KGHVKLSDFGLCTGLKK 240  human
AAF97511   227 ---------------------------------------------------------------RGHLKLSDFGLCTGLKK 243  fruit fly
T16718     214 ---------------------------------------------------------------RGHVKLSDFGLCTGLKK 230  nematode
XP_787948  316 ynlylimeflpggdmmtllmkretlseevtlfyiaetimainsihklnfihrdikpdnllldaRGHIKLSDFGLCTGLKK 395  purple urchin
NP_009202  223 ---------------------------------------------------------------KGHVKLSDFGLCTGLKK 239  human
CAK78498   222 ---------------------------------------------------------------DGHIKLSDFGLCKYVES 238  Paramecium tetra...
Q6TGC6     260 ---------------------------------------------------------------TGHIKLSDFGLSMGFHK 276  Pneumocystis car...
NP_188973  254 ---------------------------------------------------------------SGHMKLSDFGLCKPLDC 270  thale cress
XP_642376  246 ---------------------------------------------------------------KGHVKLCDLGLCTGFHR 262  Dictyostelium di...
XP_648064  226 ---------------------------------------------------------------NGHIKLTDFGLCTGFHK 242  Entamoeba histol...
XP_636570  269 ---------------------------------------------------------------KGHIKVSDFGLCTGLQT 285  Dictyostelium di...
Feature 1                                                            ######                    
Q9Y2H1     241 AHRTEFYRnlthnpps------------dfsfqnmnSKRKAETWKKNRRqLAYSTVGTPDYIAPEVFMQtgYNKLCDWWS 308  human
AAF97511   244 SHRTDFYRdlsqakpsdfig-----tcaslscspmdSKRRAESWKRNRRaLAYSTVGTPDYIAPEVFLQtgYGPACDWWS 318  fruit fly
T16718     231 FHRTDHYRnwpstlpp------------dfiskpfeSKRKAETWKRNRRaYAYSTVGTPDYIAPEVFQPngYTKSCDWWS 298  nematode
XP_787948  396 SHRTEFYRdlsqvrpndf---------sattckpmdSKRLAESWKRNRRaLAYSTVGTPDYIAPEVFLQtgYSHVCDWWS 466  purple urchin
NP_009202  240 AHRTEFYRnlnhslps------------dftfqnmnSKRKAETWKRNRRqLAFSTVGTPDYIAPEVFMQtgYNKLCDWWS 307  human
CAK78498   239 RGTRLDERisih--------------------kpedKGGNTTTFKRNRI-KAYSTVGTPDYIAPEVFGKsgYNETADWWS 297  Paramecium tetra...
Q6TGC6     277 THDNAYYQrlfeskintstsstqnslmvdtisltmsSKDKIATWKKNRRiMAYSTVGTPDYIAPEIFTQhgYGQECDWWS 356  Pneumocystis car...
NP_188973  271 SILQEKDFvvahnlsgalqs----dgrpvaprrtrsQMEQLQNWQRNRRmLAYSTVGTPDYIAPEVLLKkgYGMECDWWS 346  thale cress
XP_642376  263 LHSSEFYQmlvgdamtik--------mklieatpltQTERIASWKKARRaLAYSAVGTPDYTAPEVFLQigYNKEVDWWS 334  Dictyostelium di...
XP_648064  243 DHESSYFEivdkaskln----------lsdlksqklSKELAHNYKNKKRnLAYSVVGTPDYTAPEVFLQkgYYKECDYWS 312  Entamoeba histol...
XP_636570  286 NRVPTLAEiykkyegdnn--------ireedqtpqsRSARFDSWKRQRRvLAYSNVGTPDYTAPEVLMKdgYSAECDWWS 357  Dictyostelium di...
Feature 1            #     #  #                                                                
Q9Y2H1     309 LGVIMYEMLIGYPPFCSEtPQETYRKVMNWKETLVFPPEv-----pISEKAKDLILRFCIdSENRIGn-sGVEEIKGHPF 382  human
AAF97511   319 LGVIMYEMLMGYPPFCSDnPQDTYRKVMNWRETLIFPPEi-----pISEEAKETIINFCCeADRRLGsqrGLEDLKSVPF 393  fruit fly
T16718     299 LGVIMYEMLIGYPPFCSElPQETYRKVINWQQTLVFPSDv-----pISIEAKATIKRFCCeAERRLGnhgGLDEIKQCPF 373  nematode
XP_787948  467 LGVVMYEMLIGYPPFCSEtPQETYRKVMHWRETLQFPAEi-----pISNEAKGMIQRFCCeADRRVGk-nGVDEIKSHAF 540  purple urchin
NP_009202  308 LGVIMYEMLIGYPPFCSEtPQETYKKVMNWKETLTFPPEv-----pISEKAKDLILRFCCeWEHRIGa-pGVEEIKSNSF 381  human
CAK78498   298 LGAILFEMLVGYPPFFSDdPSSTCQKIINWKKTLVIPQEa-----kLSPAATDLILRLMTdASNRLGv-nGVNEIKAHPF 371  Paramecium tetra...
Q6TGC6     357 LGAIMFECLIGWPPFCSEnAHETYRKIINWRENLYFPEDl-----hLSAEAEDLIRKLLTsADQRLGr-yGANDIKLHPF 430  Pneumocystis car...
NP_188973  347 LGAIMYEMLVGFPPFYSDePMTTCRKIVNWKNYLKFPDEv-----rLSPEAKDLICRLLCnVEQRIGt-kGANEIKEHPW 420  thale cress
XP_642376  335 LGVILYEMVVGHPPFLSDnTTETCLKILNCKETLQIPTDm-----gLSKEVIDLIKRLVC-EKDRYK---SADEIKLHPF 405  Dictyostelium di...
XP_648064  313 VGCILFEMLAGYPPFVSDdSVQTCLKIINCNETLQFPDDv-----eIHDDAKDLIKKLVClKEKRLA---DIKLIQQHPF 384  Entamoeba histol...
XP_636570  358 VGVIMFEMLVGYPPFCSEsIRETYHKIMNWKQTLPKIMEeakaevnLSPEAQDLIERFLTdPMTRIGf-nGVEEIQSHPF 436  Dictyostelium di...
Feature 1                                                                                      
Q9Y2H1     383 FEGVDWEHirERPAAIPIEIKSIDDTSNFDDFPEsdilqpvpn--------------------------------ttepd 430  human
AAF97511   394 FRGVDWEHirERPAAIPVEVRSIDDTSNFDEFPDvsleipsap--------------------------------ipqgg 441  fruit fly
T16718     374 VKRIDWNHirERPPPIRVTVKSIDDTSNFDDFPDedltwptst-------------------------------lirpee 422  nematode
XP_787948  541 FHGVDWEHirERPAAIPTNIKSFEDTSNFDAFPEielkpitp---------------------------------pqatg 587  purple urchin
NP_009202  382 FEGVDWEHirERPAAISIEIKSIDDTSNFDEFPEsdilkptvat-----------------------------snhpetd 432  human
CAK78498   372 FAGIDWKNlrSKVSPYIPEIKSELDTRNFDKFEEqepwvpq-----------------------------------dsgk 416  Paramecium tetra...
Q6TGC6     431 FRGVNWDTirEINAPFIPQLKSITDTSYFEEIDTipnitmnsppv----------------------------lqnkips 482  Pneumocystis car...
NP_188973  421 FSGVEWEKlyQMKAAFIPQVNDELDTQNFEKFEEtdkqvpktpk-----------------------------sgpwrkm 471  thale cress
XP_642376  406 FKGVNWDNirNQSAPFVPELKSPTDTSNFDIYEEipndiddddnnnnnnsnnninlndninsnctyttptkksnimgkgn 485  Dictyostelium di...
XP_648064  385 FKGFNWDTifEQTPPYLPKLKSPFDTSNFDDFELneddveek----------------------------------pvni 430  Entamoeba histol...
XP_636570  437 FKGVDWRRlrETRPPIIPQLSSPTDTSNFDHYEEeqqpepmqpv-----------------------------qsksrrk 487  Dictyostelium di...
Feature 1                       
Q9Y2H1     431 yksKDWVFLNYTYKRFE 447  human
AAF97511   442 eiaKDWVFINYTYKRFE 458  fruit fly
T16718     423 qpgRRGEFVDFTYKRFD 439  nematode
XP_787948  588 ehmKDWVFINYTFKRFE 604  purple urchin
NP_009202  433 yknKDWVFINYTYKRFE 449  human
CAK78498   417 svrKDVNFIGYTFNREV 433  Paramecium tetraurelia
Q6TGC6     483 dvdQNLAFVGYTYKRFD 499  Pneumocystis carinii
NP_188973  472 lssKDINFVGYTYKNVE 488  thale cress
XP_642376  486 ikdKDLAFIGFTFKGFD 502  Dictyostelium discoideum AX4
XP_648064  431 nnpKDLAFVGYTYKGFL 447  Entamoeba histolytica HM-1:IMSS
XP_636570  488 itsFDIPFIGYTYRNFD 504  Dictyostelium discoideum AX4

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap