Conserved Protein Domain Family
STKc_PKB_alpha

?
cd05594: STKc_PKB_alpha (this model, PSSM-Id:173685 is obsolete and has been replaced by 270746)
Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha
Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficient in PKB-alpha exhibit perinatal morbidity, growth retardation, reduction in body weight accompanied by reduced sizes of multiple organs, and enhanced apoptosis in some cell types. PKB-alpha activity has been reported to be frequently elevated in breast and prostate cancers. In some cancer cells, PKB-alpha may act as a suppressor of metastasis.
Statistics
?
PSSM-Id: 173685
View PSSM: cd05594
Aligned: 4 rows
Threshold Bit Score: 635.139
Threshold Setting Gi: 147904038
Created: 31-Aug-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
  next features
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           ## ##   #            # #           #  #                #               ####   
gi 110825704  154 KLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGG 233
gi 147904038  155 KLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGG 234
gi 45384254   154 KLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGG 233
gi 47230282   132 KLLGKGTFGKVILVKEKATGHYYAMKILKKEVIVAKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGG 211
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         # #   #                                 # # ## #         ##  #             #####
gi 110825704  234 ELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKEVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTP 313
gi 147904038  235 ELFFHLSRERIFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTP 314
gi 45384254   234 ELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTP 313
gi 47230282   212 ELFFHLSRDRVFSEERARFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTP 291
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ###                        #     #  #                                           
gi 110825704  314 EYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLSPEAKSLLSGLLKkDPKQRLG 393
gi 147904038  315 EYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLLPEAKSLLSGLLKkDPKQRLG 394
gi 45384254   314 EYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLSPEAKSLLSGLLKkDPKQRLG 393
gi 47230282   292 EYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIRFPRTLGPEARSLLSGLLKkDPMQRLG 371
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                     #   #                               
gi 110825704  394 GGSEDAKEIMQHRFFASIVWQDVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMEGVdsERRPHFPQFS 473
gi 147904038  395 GGPDDAKEIMQHKFFAGIVWQDVYEKKLVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNFEFVdnERRPHFPQFS 474
gi 45384254   394 GGPDDAKEIMQHKFFAGIVWQDVYGKKLVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMDCVdnERRPHFPQFS 473
gi 47230282   372 GGPDDAKEIMQHKFFAGIEWKDVYEKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPGQGGSRKTVg-VRALTFHGLS 450

                  ....*
Feature 1              
gi 110825704  474 YSASA 478
gi 147904038  475 YSASG 479
gi 45384254   474 YSASG 478
gi 47230282   451 ELRPA 455

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap