Conserved Protein Domain Family
STKc_MAST_like

?
cd05579: STKc_MAST_like (this model, PSSM-Id:173670 is obsolete and has been replaced by 270731)
Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins
Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert relative to other kinases. The fungal kinases in this subfamily harbor other domains in addition to a central catalytic domain, which also contains an insert relative to MAST kinases like MASTL. Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. MAST kinases are cytoskeletal associated kinases of unknown function that are also expressed at neuromuscular junctions and postsynaptic densities. The fungal proteins Rim15 and cek1 are involved in the regulation of meiosis and mitosis, respectively.
Statistics
?
PSSM-Id: 173670
View PSSM: cd05579
Aligned: 18 rows
Threshold Bit Score: 269.503
Threshold Setting Gi: 68565604
Created: 5-Mar-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the binding of peptide substrates and ATP analogs to the AGC kinases, PKA and PKB.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         #####   #            # #                               #               ## #   # 
Q6P0Q8        518 ISNGAYGAVFLVRHkstrQRFAMKKINKqnlilrnqiQQAFVERDILTFAeNPFVVSMFCSFDTkrHLCMVMEYVeGGDC 597  human
Q96GX5         41 ISRGAFGKVYLGQKg--gKLYAVKVVKKadminknmtHQVQAERDALALSkSPFIVHLYYSLQSanNVYLVMEYLiGGDV 118  human
CAK86454      333 IGQGAYGSVFLVKRiitgDLYAMKIINCcnkrferlfEQLKQERNIFEILtGDYVVKAYYSFQHesSLCFAQEYMiGGDF 412  Paramecium te...
XP_654471     578 INGGAYSSVYLVRKkvtnDIYAMKIMKKadmirknvvDGVLAEKTILQRAqTPSVVKMYYAFQDthNLFLVMEYCpGGDL 657  Entamoeba his...
XP_651956     620 FSAGAYSRIYLVKKkstgDVYAMKVMKKddmirknvvDSVLVEKNFLSKAhNISVVKLYYAFQDdiNLYLVMEYCpGGDL 699  Entamoeba his...
XP_637522      70 ISKGGFGKVYLAENkitkKTVAIKVIKKsdtikkmmvDQVNIEKTILSNYkCNFIVELFSSFQTdkKLFFVMEFLnGGDC 149  Dictyostelium...
NP_201037     760 ISRGAFGRVFLAKKratgDLFAIKVLKKadmirknavESILAERNILISVrNPFVVRFFYSFTCreNLYLVMEYLnGGDL 839  thale cress
EAR84564     2319 ISKGAFGRVWLVRKknteDIYAMKIVNFaekmnknhlDSLKKENEILSKVqGDYVVKAVYTFTHesYICFVMEYMiGGDL 2398 Tetrahymena t...
XP_001314667  330 ISNGAFARVFLATKdklkSPVAIKVIPRrnvrgkgstNRLLTEKNIMLHFnSPYTIRFFYSTIGkhNLYMVMEYLpGGDL 409  Trichomonas v...
XP_001320042  304 ISRGAYGSVFLCQRiqtgDVFALKVIPAddls--mknDVLDTEREVMCRAlHPSTISLFWSFRAssTVFFVMSFArGGDL 381  Trichomonas v...
Feature 1         #                                     # # ## #         ##  #                    
Q6P0Q8        598 ATLLKNig-aLPVDMVRLYFAETVLALEYLHNYGIVHRDLKPDNLLITsmGHIKLTDFGLSKIGLMslttnlyegh---- 672  human
Q96GX5        119 KSLLHIyg-yFDEEMAVKYISEVALALDYLHRHGIIHRDLKPDNMLISneGHIKLTDFGLSKVTLNrdinmmdilttpsm 197  human
CAK86454      413 SKILINeg-aFDENIARHYFSEILIALEYLHNNNIVHRDLKPENILLDqyGHIKLADFGLSELGINkkmikkcsqqsfsq 491  Paramecium te...
XP_654471     658 RCLLSNvg-yLDETTAKIYSAEIVLALEYIHSLGCIHRDLKPDNVLIDknGHLLLTDFGLSTVGSKieq----------- 725  Entamoeba his...
XP_651956     700 ATLLEHig-sFNEYVAHVYSAEILLSLHYIHALGCVHKDIKPDNILINrnGHLVLTDFGLSSYGLVsqe----------- 767  Entamoeba his...
XP_637522     150 ASLLRSfnnnMPEDLTKNIIAQIIICLEYLHNHGIIHRDLKPDNILIDsnGHIKLADFGLSKFDFVdescnikilknsf- 228  Dictyostelium...
NP_201037     840 FSLLRNlg-cLDEDMARIYIAEVVLALEYLHSVNIIHRDLKPDNLLINqdGHIKLTDFGLSKVGLInstddlsgesslgn 918  thale cress
EAR84564     2399 GSIISSyg-vLEESMAKFYIAEIVVAIHNLHQIGIIHRDLKPDNLLLDsqGHLKLTDFGLSDMGLQrrnktasekkkekl 2477 Tetrahymena t...
XP_001314667  410 FSLLEKfg-cFPEDVARNYTAQIVAALEYLRQNNVIHRDLKPDNILLDsaGHLKLVDFGLSYFGVVgrqt---------- 478  Trichomonas v...
XP_001320042  382 YALLESvg-sLDEEVAAFYVAELVLAIEYIHSLNVVHCDLKPDNILINdsGHLQLTDFGLSKFGLEqrelgrslmfrfa- 459  Trichomonas v...
Feature 1                                                                                         
Q6P0Q8            --------------------------------------------------------------------------------      human
Q96GX5        198 akprqdysrtpgqvlslisslgfntpiaeknqdpanilsaclsetsqlsqglvcpmsvdqkdttpysskllkscletvas 277  human
CAK86454      492 sdsspsp------------------------------------------------------------------------- 498  Paramecium te...
XP_654471         --------------------------------------------------------------------------------      Entamoeba his...
XP_651956         --------------------------------------------------------------------------------      Entamoeba his...
XP_637522         --------------------------------------------------------------------------------      Dictyostelium...
NP_201037     919 sgff---------------------------------------------------------------------------- 922  thale cress
EAR84564     2478 kifnnlqknnkafqkfddrinqn--------------------------------------------------------- 2500 Tetrahymena t...
XP_001314667      --------------------------------------------------------------------------------      Trichomonas v...
XP_001320042      --------------------------------------------------------------------------------      Trichomonas v...
Feature 1                                                                                         
Q6P0Q8            --------------------------------------------------------------------------------      human
Q96GX5        278 npgmpvkcltsnllqsrkrlatssassqshtfissvesechsspkwekdcqesdealgptmmswnaveklcaksanaiet 357  human
CAK86454          --------------------------------------------------------------------------------      Paramecium te...
XP_654471         --------------------------------------------------------------------------------      Entamoeba his...
XP_651956         --------------------------------------------------------------------------------      Entamoeba his...
XP_637522         --------------------------------------------------------------------------------      Dictyostelium...
NP_201037         --------------------------------------------------------------------------------      thale cress
EAR84564          --------------------------------------------------------------------------------      Tetrahymena t...
XP_001314667      --------------------------------------------------------------------------------      Trichomonas v...
XP_001320042      --------------------------------------------------------------------------------      Trichomonas v...
Feature 1                                                                                         
Q6P0Q8            --------------------------------------------------------------------------------      human
Q96GX5        358 kgfnkkdlelalspihnssalpttgrscvnlakkcfsgevsweaveldvnninmdtdtsqlgfhqsnqwavdsggiseeh 437  human
CAK86454          --------------------------------------------------------------------------------      Paramecium te...
XP_654471         --------------------------------------------------------------------------------      Entamoeba his...
XP_651956         --------------------------------------------------------------------------------      Entamoeba his...
XP_637522         --------------------------------------------------------------------------------      Dictyostelium...
NP_201037         --------------------------------------------------------------------------------      thale cress
EAR84564          --------------------------------------------------------------------------------      Tetrahymena t...
XP_001314667      --------------------------------------------------------------------------------      Trichomonas v...
XP_001320042      --------------------------------------------------------------------------------      Trichomonas v...
Feature 1                                                                                         
Q6P0Q8            --------------------------------------------------------------------------------      human
Q96GX5        438 lgkrslkrnfelvdsspckkiiqnkktcveykhnemtncytnqntgltvevqdlklsvhksqqndcankenivnsftdkq 517  human
CAK86454          --------------------------------------------------------------------------------      Paramecium te...
XP_654471         --------------------------------------------------------------------------------      Entamoeba his...
XP_651956         --------------------------------------------------------------------------------      Entamoeba his...
XP_637522         --------------------------------------------------------------------------------      Dictyostelium...
NP_201037         --------------------------------------------------------------------------------      thale cress
EAR84564          --------------------------------------------------------------------------------      Tetrahymena t...
XP_001314667      --------------------------------------------------------------------------------      Trichomonas v...
XP_001320042      --------------------------------------------------------------------------------      Trichomonas v...
Feature 1                                                                                         
Q6P0Q8            --------------------------------------------------------------------------------      human
Q96GX5        518 qtpeklpipmiaknlmceldedceknskrdylsssflcsdddrasknismnsdssfpgisimesplesqpldsdrsikes 597  human
CAK86454          --------------------------------------------------------------------------------      Paramecium te...
XP_654471         --------------------------------------------------------------------------------      Entamoeba his...
XP_651956         --------------------------------------------------------------------------------      Entamoeba his...
XP_637522         --------------------------------------------------------------------------------      Dictyostelium...
NP_201037         --------------------------------------------------------------------------------      thale cress
EAR84564          --------------------------------------------------------------------------------      Tetrahymena t...
XP_001314667      --------------------------------------------------------------------------------      Trichomonas v...
XP_001320042      --------------------------------------------------------------------------------      Trichomonas v...
Feature 1                                                                                         
Q6P0Q8            --------------------------------------------------------------------------------      human
Q96GX5        598 sfeesniedplivtpdcqektspkgvenpavqesnqkmlgpplevlktlaskrnavafrsfnshinasnnsepsrmnmts 677  human
CAK86454          --------------------------------------------------------------------------------      Paramecium te...
XP_654471         --------------------------------------------------------------------------------      Entamoeba his...
XP_651956         --------------------------------------------------------------------------------      Entamoeba his...
XP_637522         --------------------------------------------------------------------------------      Dictyostelium...
NP_201037         --------------------------------------------------------------------------------      thale cress
EAR84564          --------------------------------------------------------------------------------      Tetrahymena t...
XP_001314667      --------------------------------------------------------------------------------      Trichomonas v...
XP_001320042      --------------------------------------------------------------------------------      Trichomonas v...
Feature 1                                                                     ######              
Q6P0Q8        673 ------------------------------------------------iekdareflDKQVCGTPEYIAPEVILRqg-yg 703  human
Q96GX5        678 ldamdiscaysgsypmaitptqkrrscmphqqtpnqiksgtpyrtpksvrrgvapvdDGRILGTPDYLAPELLLGra-hg 756  human
CAK86454      499 -------------------------------------iyqmkkgrsfkksnispenaDRRIIGTPDYIAPEIIRGqsfsh 541  Paramecium te...
XP_654471     726 ------------------------------------------------------tveDSRLVCTPDYVAPESIVSfq-ys 750  Entamoeba his...
XP_651956     768 ------------------------------------------------------tagKTGIFCTPDYAAPEILISns-ys 792  Entamoeba his...
XP_637522     229 ---------------------------------------------tlyntnnnntteNQKILGTPYYIPPEVILGkg-yg 262  Dictyostelium...
NP_201037     923 ----------------------------------------aedgskaqhsqgkdsrkKHAVVGTPDYLAPEILLGmg-hg 961  thale cress
EAR84564     2501 ---------------------dkfdkqkkpirqeilemkknvdslnilklnnkiskpANRIIGTPDYIAPEILKGeglqn 2559 Tetrahymena t...
XP_001314667  479 ------------------------------------------------------dthESTALGTPDYIAPEIITLen-hs 503  Trichomonas v...
XP_001320042  460 ---------------------------------------------pssatksdtndhKRRVIGTPHYISPESLLRsd-ys 493  Trichomonas v...
Feature 1                      #     #  #                                                         
Q6P0Q8        704 KPVDWWAMGIILYEFLVGCVPFFGDt---------------pEELFGQVIs--dEIVWPEgde-----alpPDAQDLTSK 761  human
Q96GX5        757 PAVDWWALGVCLFEFLTGIPPFNDEt---------------pQQVFQNILk--rDIPWPEgee-----klsDNAQSAVEI 814  human
CAK86454      542 KSQDFWSLGIILYEFLVGIPPFNDEs---------------vEKIYQNILk--gDIEWPEigndp-eeqisQQAFDLLTK 603  Paramecium te...
XP_654471     751 RCSDYFSLGSMIFEFICGIPPFHEEt---------------pDAIFQNIRt--gKYSWPSsin------psNELKSIVSG 807  Entamoeba his...
XP_651956     793 FASDYFALGCMLYEFVVGYPPFNASt---------------pEAIFMKIQq--gVYEWPEdvd------vsDDCKDLVSK 849  Entamoeba his...
XP_637522     263 KTIDWWSLGIILYEFLIGYPPFQEDepnesinpksdndeknvRIIFNKITnhkkKLYFPKkl--------yPVAIDLIEK 334  Dictyostelium...
NP_201037     962 KTADWWSVGVILFEVLVGIPPFNAEt---------------pQQIFENIIn--rDIPWPNvpe-----eisYEAHDLINK 1019 thale cress
EAR84564     2560 PAIDWWSVGVMLFELLIGIPPFNDDt---------------vEKIFDNIKn--yRIAWDQipvgdgedevsQKSVNLIKK 2622 Tetrahymena t...
XP_001314667  504 YQADYWSLGAMLYEFITGVAPFHDNt---------------pQEIFSNVLc--gSINFKEleem----nasKDCIDFIQK 562  Trichomonas v...
XP_001320042  494 PKVDWWALGVIAYELVVGEPPFGGNs---------------eAEIFSHIVa--gKYEWPDdve------vsDEYKKFVHD 550  Trichomonas v...
Feature 1                                      
Q6P0Q8        762 LLHqnPLERLGtgsayEVKQHPFFTGLDW 790  human
Q96GX5        815 LLTidDTKRAGm---kELKRHPLFSDVDW 840  human
CAK86454      604 LLNpdYTQRLGygsieEIKNHPFLASINW 632  Paramecium tetraurelia
XP_654471     808 LLTveVKKRLGyksvqEIKSHPWFEGINW 836  Entamoeba histolytica HM-1:IMSS
XP_651956     850 LLCpePEKRPVf---kQIENHPFFSDIHW 875  Entamoeba histolytica HM-1:IMSS
XP_637522     335 LLDpnPSVRLGangvdEVKCHPFFSEINW 363  Dictyostelium discoideum AX4
NP_201037    1020 LLTenPVQRLGatgagEVKQHHFFKDINW 1048 thale cress
EAR84564     2623 LMHpdPKQRLGsqgiiQIQSDPFFTGIDW 2651 Tetrahymena thermophila SB210
XP_001314667  563 LLVsdPKKRLGaesidEIKHHPWFNGIDW 591  Trichomonas vaginalis G3
XP_001320042  551 LLNlnPEKRPDa---eELKKYKIFEDIDW 576  Trichomonas vaginalis G3

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap