Conserved Protein Domain Family
STKc_MAST_like

?
cd05579: STKc_MAST_like (this model, PSSM-Id:173670 is obsolete and has been replaced by 270731)
Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins
Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert relative to other kinases. The fungal kinases in this subfamily harbor other domains in addition to a central catalytic domain, which also contains an insert relative to MAST kinases like MASTL. Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. MAST kinases are cytoskeletal associated kinases of unknown function that are also expressed at neuromuscular junctions and postsynaptic densities. The fungal proteins Rim15 and cek1 are involved in the regulation of meiosis and mitosis, respectively.
Statistics
?
PSSM-Id: 173670
View PSSM: cd05579
Aligned: 18 rows
Threshold Bit Score: 269.503
Threshold Setting Gi: 68565604
Created: 5-Mar-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the binding of peptide substrates and ATP analogs to the AGC kinases, PKA and PKB.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #####   #            # #                               #               ## #   # 
gi 62287152   518 ISNGAYGAVFLVRHkstrQRFAMKKINKqnlilrnqiQQAFVERDILTFAeNPFVVSMFCSFDTkrHLCMVMEYVeGGDC 597
gi 68565604    41 ISRGAFGKVYLGQKg--gKLYAVKVVKKadminknmtHQVQAERDALALSkSPFIVHLYYSLQSanNVYLVMEYLiGGDV 118
gi 124421584  333 IGQGAYGSVFLVKRiitgDLYAMKIINCcnkrferlfEQLKQERNIFEILtGDYVVKAYYSFQHesSLCFAQEYMiGGDF 412
gi 67478098   578 INGGAYSSVYLVRKkvtnDIYAMKIMKKadmirknvvDGVLAEKTILQRAqTPSVVKMYYAFQDthNLFLVMEYCpGGDL 657
gi 67472192   620 FSAGAYSRIYLVKKkstgDVYAMKVMKKddmirknvvDSVLVEKNFLSKAhNISVVKLYYAFQDdiNLYLVMEYCpGGDL 699
gi 66807599    70 ISKGGFGKVYLAENkitkKTVAIKVIKKsdtikkmmvDQVNIEKTILSNYkCNFIVELFSSFQTdkKLFFVMEFLnGGDC 149
gi 15241795   760 ISRGAFGRVFLAKKratgDLFAIKVLKKadmirknavESILAERNILISVrNPFVVRFFYSFTCreNLYLVMEYLnGGDL 839
gi 89286566  2319 ISKGAFGRVWLVRKknteDIYAMKIVNFaekmnknhlDSLKKENEILSKVqGDYVVKAVYTFTHesYICFVMEYMiGGDL 2398
gi 123976849  330 ISNGAFARVFLATKdklkSPVAIKVIPRrnvrgkgstNRLLTEKNIMLHFnSPYTIRFFYSTIGkhNLYMVMEYLpGGDL 409
gi 123473711  304 ISRGAYGSVFLCQRiqtgDVFALKVIPAddls--mknDVLDTEREVMCRAlHPSTISLFWSFRAssTVFFVMSFArGGDL 381
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #                                     # # ## #         ##  #                    
gi 62287152   598 ATLLKNig-aLPVDMVRLYFAETVLALEYLHNYGIVHRDLKPDNLLITsmGHIKLTDFGLSKIGLMslttnlyegh---- 672
gi 68565604   119 KSLLHIyg-yFDEEMAVKYISEVALALDYLHRHGIIHRDLKPDNMLISneGHIKLTDFGLSKVTLNrdinmmdilttpsm 197
gi 124421584  413 SKILINeg-aFDENIARHYFSEILIALEYLHNNNIVHRDLKPENILLDqyGHIKLADFGLSELGINkkmikkcsqqsfsq 491
gi 67478098   658 RCLLSNvg-yLDETTAKIYSAEIVLALEYIHSLGCIHRDLKPDNVLIDknGHLLLTDFGLSTVGSKieq----------- 725
gi 67472192   700 ATLLEHig-sFNEYVAHVYSAEILLSLHYIHALGCVHKDIKPDNILINrnGHLVLTDFGLSSYGLVsqe----------- 767
gi 66807599   150 ASLLRSfnnnMPEDLTKNIIAQIIICLEYLHNHGIIHRDLKPDNILIDsnGHIKLADFGLSKFDFVdescnikilknsf- 228
gi 15241795   840 FSLLRNlg-cLDEDMARIYIAEVVLALEYLHSVNIIHRDLKPDNLLINqdGHIKLTDFGLSKVGLInstddlsgesslgn 918
gi 89286566  2399 GSIISSyg-vLEESMAKFYIAEIVVAIHNLHQIGIIHRDLKPDNLLLDsqGHLKLTDFGLSDMGLQrrnktasekkkekl 2477
gi 123976849  410 FSLLEKfg-cFPEDVARNYTAQIVAALEYLRQNNVIHRDLKPDNILLDsaGHLKLVDFGLSYFGVVgrqt---------- 478
gi 123473711  382 YALLESvg-sLDEEVAAFYVAELVLAIEYIHSLNVVHCDLKPDNILINdsGHLQLTDFGLSKFGLEqrelgrslmfrfa- 459
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 62287152       --------------------------------------------------------------------------------
gi 68565604   198 akprqdysrtpgqvlslisslgfntpiaeknqdpanilsaclsetsqlsqglvcpmsvdqkdttpysskllkscletvas 277
gi 124421584  492 sdsspsp------------------------------------------------------------------------- 498
gi 67478098       --------------------------------------------------------------------------------
gi 67472192       --------------------------------------------------------------------------------
gi 66807599       --------------------------------------------------------------------------------
gi 15241795   919 sgff---------------------------------------------------------------------------- 922
gi 89286566  2478 kifnnlqknnkafqkfddrinqn--------------------------------------------------------- 2500
gi 123976849      --------------------------------------------------------------------------------
gi 123473711      --------------------------------------------------------------------------------
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 62287152       --------------------------------------------------------------------------------
gi 68565604   278 npgmpvkcltsnllqsrkrlatssassqshtfissvesechsspkwekdcqesdealgptmmswnaveklcaksanaiet 357
gi 124421584      --------------------------------------------------------------------------------
gi 67478098       --------------------------------------------------------------------------------
gi 67472192       --------------------------------------------------------------------------------
gi 66807599       --------------------------------------------------------------------------------
gi 15241795       --------------------------------------------------------------------------------
gi 89286566       --------------------------------------------------------------------------------
gi 123976849      --------------------------------------------------------------------------------
gi 123473711      --------------------------------------------------------------------------------
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 62287152       --------------------------------------------------------------------------------
gi 68565604   358 kgfnkkdlelalspihnssalpttgrscvnlakkcfsgevsweaveldvnninmdtdtsqlgfhqsnqwavdsggiseeh 437
gi 124421584      --------------------------------------------------------------------------------
gi 67478098       --------------------------------------------------------------------------------
gi 67472192       --------------------------------------------------------------------------------
gi 66807599       --------------------------------------------------------------------------------
gi 15241795       --------------------------------------------------------------------------------
gi 89286566       --------------------------------------------------------------------------------
gi 123976849      --------------------------------------------------------------------------------
gi 123473711      --------------------------------------------------------------------------------
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 62287152       --------------------------------------------------------------------------------
gi 68565604   438 lgkrslkrnfelvdsspckkiiqnkktcveykhnemtncytnqntgltvevqdlklsvhksqqndcankenivnsftdkq 517
gi 124421584      --------------------------------------------------------------------------------
gi 67478098       --------------------------------------------------------------------------------
gi 67472192       --------------------------------------------------------------------------------
gi 66807599       --------------------------------------------------------------------------------
gi 15241795       --------------------------------------------------------------------------------
gi 89286566       --------------------------------------------------------------------------------
gi 123976849      --------------------------------------------------------------------------------
gi 123473711      --------------------------------------------------------------------------------
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 62287152       --------------------------------------------------------------------------------
gi 68565604   518 qtpeklpipmiaknlmceldedceknskrdylsssflcsdddrasknismnsdssfpgisimesplesqpldsdrsikes 597
gi 124421584      --------------------------------------------------------------------------------
gi 67478098       --------------------------------------------------------------------------------
gi 67472192       --------------------------------------------------------------------------------
gi 66807599       --------------------------------------------------------------------------------
gi 15241795       --------------------------------------------------------------------------------
gi 89286566       --------------------------------------------------------------------------------
gi 123976849      --------------------------------------------------------------------------------
gi 123473711      --------------------------------------------------------------------------------
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 62287152       --------------------------------------------------------------------------------
gi 68565604   598 sfeesniedplivtpdcqektspkgvenpavqesnqkmlgpplevlktlaskrnavafrsfnshinasnnsepsrmnmts 677
gi 124421584      --------------------------------------------------------------------------------
gi 67478098       --------------------------------------------------------------------------------
gi 67472192       --------------------------------------------------------------------------------
gi 66807599       --------------------------------------------------------------------------------
gi 15241795       --------------------------------------------------------------------------------
gi 89286566       --------------------------------------------------------------------------------
gi 123976849      --------------------------------------------------------------------------------
gi 123473711      --------------------------------------------------------------------------------
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                     ######              
gi 62287152   673 ------------------------------------------------iekdareflDKQVCGTPEYIAPEVILRqg-yg 703
gi 68565604   678 ldamdiscaysgsypmaitptqkrrscmphqqtpnqiksgtpyrtpksvrrgvapvdDGRILGTPDYLAPELLLGra-hg 756
gi 124421584  499 -------------------------------------iyqmkkgrsfkksnispenaDRRIIGTPDYIAPEIIRGqsfsh 541
gi 67478098   726 ------------------------------------------------------tveDSRLVCTPDYVAPESIVSfq-ys 750
gi 67472192   768 ------------------------------------------------------tagKTGIFCTPDYAAPEILISns-ys 792
gi 66807599   229 ---------------------------------------------tlyntnnnntteNQKILGTPYYIPPEVILGkg-yg 262
gi 15241795   923 ----------------------------------------aedgskaqhsqgkdsrkKHAVVGTPDYLAPEILLGmg-hg 961
gi 89286566  2501 ---------------------dkfdkqkkpirqeilemkknvdslnilklnnkiskpANRIIGTPDYIAPEILKGeglqn 2559
gi 123976849  479 ------------------------------------------------------dthESTALGTPDYIAPEIITLen-hs 503
gi 123473711  460 ---------------------------------------------pssatksdtndhKRRVIGTPHYISPESLLRsd-ys 493
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                      #     #  #                                                         
gi 62287152   704 KPVDWWAMGIILYEFLVGCVPFFGDt---------------pEELFGQVIs--dEIVWPEgde-----alpPDAQDLTSK 761
gi 68565604   757 PAVDWWALGVCLFEFLTGIPPFNDEt---------------pQQVFQNILk--rDIPWPEgee-----klsDNAQSAVEI 814
gi 124421584  542 KSQDFWSLGIILYEFLVGIPPFNDEs---------------vEKIYQNILk--gDIEWPEigndp-eeqisQQAFDLLTK 603
gi 67478098   751 RCSDYFSLGSMIFEFICGIPPFHEEt---------------pDAIFQNIRt--gKYSWPSsin------psNELKSIVSG 807
gi 67472192   793 FASDYFALGCMLYEFVVGYPPFNASt---------------pEAIFMKIQq--gVYEWPEdvd------vsDDCKDLVSK 849
gi 66807599   263 KTIDWWSLGIILYEFLIGYPPFQEDepnesinpksdndeknvRIIFNKITnhkkKLYFPKkl--------yPVAIDLIEK 334
gi 15241795   962 KTADWWSVGVILFEVLVGIPPFNAEt---------------pQQIFENIIn--rDIPWPNvpe-----eisYEAHDLINK 1019
gi 89286566  2560 PAIDWWSVGVMLFELLIGIPPFNDDt---------------vEKIFDNIKn--yRIAWDQipvgdgedevsQKSVNLIKK 2622
gi 123976849  504 YQADYWSLGAMLYEFITGVAPFHDNt---------------pQEIFSNVLc--gSINFKEleem----nasKDCIDFIQK 562
gi 123473711  494 PKVDWWALGVIAYELVVGEPPFGGNs---------------eAEIFSHIVa--gKYEWPDdve------vsDEYKKFVHD 550
                         810       820
                  ....*....|....*....|....*....
Feature 1                                      
gi 62287152   762 LLHqnPLERLGtgsayEVKQHPFFTGLDW 790
gi 68565604   815 LLTidDTKRAGm---kELKRHPLFSDVDW 840
gi 124421584  604 LLNpdYTQRLGygsieEIKNHPFLASINW 632
gi 67478098   808 LLTveVKKRLGyksvqEIKSHPWFEGINW 836
gi 67472192   850 LLCpePEKRPVf---kQIENHPFFSDIHW 875
gi 66807599   335 LLDpnPSVRLGangvdEVKCHPFFSEINW 363
gi 15241795  1020 LLTenPVQRLGatgagEVKQHHFFKDINW 1048
gi 89286566  2623 LMHpdPKQRLGsqgiiQIQSDPFFTGIDW 2651
gi 123976849  563 LLVsdPKKRLGaesidEIKHHPWFNGIDW 591
gi 123473711  551 LLNlnPEKRPDa---eELKKYKIFEDIDW 576

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap