Conserved Protein Domain Family
PTZ00325

?
PTZ00325: PTZ00325 (this model, PSSM-Id:173524 is obsolete and has been replaced by 240360)
malate dehydrogenase; Provisional
Statistics
?
PSSM-Id: 173524
View PSSM: PTZ00325
Aligned: 23 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 9-Dec-2010
Updated: 15-Dec-2010
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71746906    7 RAQTRRVTGKVVVFGATTNVGKHLSLLL-TLSPQVKELCCFDPlndvtlrmteTRVRGIVKDLSHIDTGVVLRAVDDPQQ 85 
71749346    1 -------MVSVAVIGAAGGIGQSLSLLLlRQLPYGSTLSLYDV----------AGAPGVAADLSHVDRAGVTVKYAAGKL 63 
71423452    1 -------MVNVAVIGAAGGIGQSLSLLLlRELPFGSTLSLYDV----------AGAPGVAADLSHIDRAGITVKHAAGKL 63 
71656813    1 -------MVNVAVIGAAGGIGQSLSLLLlRELPFGSTLSLYDV----------VGAPGVAADLSHIDRAGITVKHAAGKL 63 
146084531   1 -------MVNVCVVGAAGGIGQSLSLLLvRQLPYGSTLSLFDV----------VGAAGVAADLSHVDNAGVQVKFAAGKI 63 
154336107   1 MKQSILSRFKVAVLGASGAIGQPLSMAL-VQNKRVSDLALYDI----------VQPRGIAVDLSHFPRKVKIAGYPTKWI 69 
154335924   1 -------MVNVCVVGAAGGIGQPLSLLLmRQLPYGSTLSLFDV----------VGTAGVAADLSHVDNVGVQIKYATGKV 63 
157868190   1 -------MVNVCVVGAAGGIGQSLSLLLvRQLPYGSTLSLFDV----------VGAAGVAADLSHVDNAGVQVKFAEGKI 63 
71414197   24 RVAPKKTSGKVVVFGATTVVGQPLLLLL-KLCPHVKEICCCGPltkvdpganfITARGVAADLSHIDTNTSVKAFETPCD 102
154336111   7 RSPAALKKAKVVLFGCNSAVGQPLSLLL-KLNPHVEELVCCSTaad-----ddMPGAGIAADLSHVDTLPKVHYAADEGQ 80 
71746906   86 w--------EPAMRNAQLVLICTGSIPNPsRLQRDLALAECAPEYLVAMELVARAAPHAIVGIASGPVNSLVPLAREVLL 157
71749346   64 ppvkrdpalAELARGVDVFVIVAGVPRKP-GMSRDDLFNVNAGIIMDLVLTCGSSSPQACFCVVTNPVNSTVPIAAEALK 142
71423452   64 pplsrdpalTELAEGVDVFVIVAGVPRKP-GMTRDDLFNVNAGIVMDLVLTCASVSPSACFCIITNPVNSMVPIAAQTLR 142
71656813   64 ppvprdpalTELAEGVDVFVIVAGVPRKP-GMTRDDLFNVNAGIVMDLVLTCASVSPNACFCIVTNPVNSTTPIAAQTLR 142
146084531  64 gqkr-dpalAELAKGVDVFVMVAGVPRKP-GMTRDDLFKINAGIILDLVLTCASSSPKAVFCIVTNPVNSTVVIAAEALK 141
154336107  70 ---------HKALDGADVVLMPAGMPRRP-GMTHDDLFNTNALTVHELSAAVARYSPKAILAIISNPLNSLVPVAAETLR 139
154335924  64 gvpr-dpalAELAKGVDVFVVVAGVPRKP-GMTRDDLFKVNAGIMLDLVLTCASSSPRAVFCIVTNPVNSTAAIAAEALK 141
157868190  64 ghkr-dpalAELAKGVDVFVMVAGVPRKP-GMTRDDLFKINAGIILDLVLTCASSSPKAVFCIVTNPVNSTVAIAAEALK 141
71414197  103 w--------ESALRGAQLVLFCAGSVFDPsRAYRDVALRESGPELMLAMELVAKASPKAIIGVVSSPVNALVPIAREVLV 174
154336111  81 w--------PVLLRDAQLILLCFGRSFDPlHQDRDRVLKVAAPMARRIMDAVAASDAKGNIAVVSSPVNALTPLCAEFLK 152
71746906  158 RHSAFDPRKLFGITSRDVMRTRVLFAKELHMNPYDVN-VHVVGGKGDATVCPLITQTGFQLPHQR-MVQLCEEVQRPEnf 235
71749346  143 KLGIYNKNKLLGVTLLDGLRATRFINNA--RHPLAVAsVPVVGGHSDVTIVPLFSQLPGPLPEEGeLTQIRKRVQVAG-- 218
71423452  143 KIGVYNKNKLLGVSLLDGLRATRFINNA--RHPLVVPyVPVVGGHSDVTIVPLYSQIPGPLPDEStLKEIRKRVQVAG-- 218
71656813  143 KIGVYNKNKLLGVSLLDGLRATRFINNA--RHPLVVPyVPVVGGHSDVTIVPLYSQIPGPLPDEStLKEIRKRVQVAG-- 218
146084531 142 SLGVYDRNRLLGVSLLDGLRATCFINEA--RKPLVVTqVPVVGGHSDATIVPLFHQLLGPLPEQAtLDKIVKRVQVAG-- 217
154336107 140 RAGVYDPRKVFGLITLNMMRARKMLGDFAGLDPETLD-VPVIGGHSGQTIVPLFSQSGVALTREQ-AEYLTHRVRVGG-- 215
154335924 142 SLGVYDRNRLLGVSLLDGLRATRFINEA--RKPLAVNqVPVVGGHSDTTIVPLFHQLLGPLPAQEvLDKMVKRVQVAG-- 217
157868190 142 SLGVYDRNRLLGVSLLDGLRATCFINEA--RKPLVVSqVPVVGGHSDTTIVPLFYQLPGPLPEQAtLDKIVKRVQVAG-- 217
71414197  175 RNGVFDPRKLFGVTTLDIIRTRSLVADELQMNPYDLN-VPVVGGRGGVTACPLVAQTALQIPHER-IIHVCSRVQSYGsh 252
154336111 153 ASGKFDPRKLFGVTTLDVIRTRKLVAAALHMNPYDVS-VPVVGGRGGVTTCPLIAQTGLRIPLED-IIRISGEVQSYGvp 230
71746906  236 tagdhnstgcrvdSQNVQGQEKFTCPTLSTANAAYEWVTSIMKAQRGDRGITECSFVESSIK-RETPFFSSRVELGEEGA 314
71749346  219 -------------TEVVKAKAGRGSATLSMAEAGARFAMFVVNAITGQSSPMVYAYVDTDGT-QNCSFLAIPVVLGKNGI 284
71423452  219 -------------TEVVKAKAGRGSATLSMAEAGARFTMHVVKALMGLDTPMVYAYVDTDGT-HECPFLAIPVVLGKNGI 284
71656813  219 -------------TEVVKAKAGRGSATLSMAEAGARFTMHVVKALMGLDTPMVYAYVDTDGE-HECPFLAMPVVLGKNGI 284
146084531 218 -------------TEVVKAKAGRGSATLSMAEAGARFTLKVVEGLTGTGKPLVYAYVDTDGQ-HETPFLAIPVVLGVNGI 283
154336107 216 -------------DEVVRAKEGHGSSSLSMALAAAEWTEGVLRAMDGEKNLLRCSFVESPLFaDKCRFFGSTVEVGKEGV 282
154335924 218 -------------TEVVKAKAGRGSATLSMAEAGARFTLKVVEGLTGAGNPLVYAYVDTDGQ-HELPFLAIPVILGRHGI 283
157868190 218 -------------TEVVKAKAGRGSATLSMAEAGARFALKVVEGLTGTGNPLVYAYVDTDGQ-HETTFLAIPVVLGMNGI 283
71414197  253 ssyeesvgfpdlcSEEAVSTEIVPPVGLSLAYAVLEWSVSMLKALRGDQGIIECSFVESAMR-KESPFFSSRVELGEEGV 331
154336111 231 fev-----ivgtgLHDLLSTEAAPPVALSLAYATCDFSTSLLKAQRGDVGIVECALVESTMR-PETSFFSSRVELGRDGV 304
71746906  315 AQLLPlGALTPYEEELVAAA 334
71749346  285 EKRLPiGPMNAVEKEMLKQS 304
71423452  285 ERRLPiGPITTVEKEMLEEA 304
71656813  285 ERRLPiGPITTVEKEMLEEA 304
146084531 284 EKRLPiGPLHSTEETLLKAA 303
154336107 283 ERVLPlPPLDEYEEEQLDRC 302
154335924 284 EKRLPiGPLHPTEEKILKEA 303
157868190 284 EKRLPiGPLHSTEETLLKAA 303
71414197  332 AQLLPmGPLTSYETELVETA 351
154336111 305 QRIFPmGALTTYEHELIETA 324
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap