Conserved Protein Domain Family
PTZ00057

?
PTZ00057: PTZ00057 
glutathione s-transferase; Provisional
Statistics
?
PSSM-Id: 173353
View PSSM: PTZ00057
Aligned: 3 rows
Threshold Bit Score: 339.651
Threshold Setting Gi: 221060344
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PTZ00057 is classified as a model that may span more than one domain.
PTZ00057 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124808609   1 MGDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLS 80
gi 156102146   1 MAEEIVLYYFDARGKAELIRLIFAYLGIQYTDKRFGENGDAFIEFKNFKKEKETPFNQVPILEMDNIIFAQSQAIVRYLS 80
gi 221060344   1 MAEEIVLYYFDARGKAELIRLIFAYLGIKYTDKRFGEKGDAFIEFKNFKKEKKTPFEQVPILEMDNIIFAQSQAIVRYLS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124808609  81 KKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNnnndkyYFVGNNLTY 160
gi 156102146  81 KKYKISGNSELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEELPKWSGYFENILKKNNCN------YFVGDDLTY 154
gi 221060344  81 KKYKIGGDTDLDEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEELPKWSGYFENILKKNKCH------YFVGDNLTY 154
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|.
gi 124808609 161 ADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKESVY 211
gi 156102146 155 ADLAVFNLYDDIETKYPNSLKNFPLLKAHNEFISNLPNIKNYISNRKESVY 205
gi 221060344 155 ADLAVFNLYDDIETKYPNSLKNFPLLKAHNEFISNLPNIKNYISNRKESVY 205
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap