Conserved Protein Domain Family
PRK13870

?
PRK13870: PRK13870 
transcriptional regulator TraR; Provisional
Statistics
?
PSSM-Id: 172390
View PSSM: PRK13870
Aligned: 10 rows
Threshold Bit Score: 403.991
Threshold Setting Gi: 10955061
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10954936    1 MQHWLDKLTDLAAIQGDECILKDGLADLAEHFGFTGYAYLHIQHKHTIAVTNYHRDWRSAYFENNFDKLDPVVKRAKSRK 80
gi 10955045    1 MQHWLDKLTDLAAIEGDECILKTGLADIADHFGFTGYAYLHIQHRHITAVTNYHRQWQSTYFDKKFEALDPVVKRARSRK 80
gi 10955061    1 MQTWLEKLTDLAAIEGDECILKTGLADIADHFGFTGYAYLHIQHRHITAVTNYHREWQSVYFDKKFDTLDPVIKRARSRK 80
gi 16119952    1 MQHWLDKLTDLAAIQGDECILKDGLADLAEHFGFTGYAYLHIQHKHTIAVTNYHRDWRSAYFENNFDKLDPVVKRAKSRK 80
gi 190014846   1 MQHWLDKLTDLAAIEGDECILKTGLADIAEHYGFTGYAYLHIQHRHITAVTNYHREWQSTYFDKKLVALDPVVKRARSRK 80
gi 222109041   1 MQHWLDKLTDLTAIEGDECILKTGLADVADHFGFTGYAYLHIQHKHIIAVTNYHHDWRSLYFDKKFDALDPVVKRARSRK 80
gi 222109015   1 MQHWLDKLTDLTAIEGDECILKTGLADVADHFGFTGYAYLHIQHKHIIAVTNYHHDWRSLYFDKKFDALDPVVKRARSRK 80
gi 222080291   1 ----MDKLTDLAAIEGDECILKTGLADIADHFGFTGYAYLHIQHRHITAVTNYHPEWQSVYFDKKFDALDPVVKRARSRK 76
gi 222080193   1 -------MTDLAAIEGDECILKTGLADIADHFGFTGYAYLHIQHRHITAVTNYHPEWQSVYFDKKFDALDPVVKRARSRK 73
gi 222083272   1 MQHWLDRLTDLAAIQGDESILTQGLADLTQHFGFTGYAYLHIQHKHTIAVTNYHREWRSTYFDKHFDKLDPVVKRAKSRK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10954936   81 QVFAWSGEQERSRLSKEERAFYAHAADFGIRSGITIPIKTANGSMSMFTLASERPAIDLDREIDAVAAAGAVGQLHARIS 160
gi 10955045   81 HIFTWSGEHERPTLSKDERAFYDHASDFGIRSGITIPIKTANGFMSMFTMASDKPVIDLDREIDAVAAAATIGQIHARIS 160
gi 10955061   81 HIFTWSGEQEGPSLSKDERTFYALAADFGIRSGISIPIKTANGSMSMFTLASEKPVIDLDREIDAVAAAATIGQIHSRIS 160
gi 16119952   81 HVFAWSGEQERSRLSKEERAFYAHAADFGIRSGITIPIKTANGSMSMFTLASERPAIDLDREIDAAAAAGAVGQLHARIS 160
gi 190014846  81 HIFTWSGEQERPSLSRDERSFYARAADFGIRSGITIPIRTANGSMSMFTLASDKPVIDLDREIDAVAAASTIGQIHARIS 160
gi 222109041  81 QVFAWSGEQERPALSKEERAFYAQAADFGIRSGITIPIRTANGSMSMFTLASERTAIPLDREIDAVAAAAAVGQLHARIS 160
gi 222109015  81 HVFAWSGEQERPALSKEERAFYAQAADFGIRSGITIPIRTANGSMSMFTLASERTAIPLDREIDAVAAAAAVGQLHARIS 160
gi 222080291  77 HIFTWSGEHERPTLSKDERAFYAHAADFGIRSGITIPIKTANGSMSMFTLASEKPVIDLDREIDAVAAAGTIGQIHARIS 156
gi 222080193  74 HIFTWSGEHERPTLSKDERAFYAHAADFGIRSGITIPIKTANGSMSMFTLASEKPVIDLDREIDAVAAAGTIGQIHARIS 153
gi 222083272  81 QVFAWSGEQDRARQSKEERAFYAHAADFGIRSGVTVPIKTANGSMSMFTLASEKPAIDLDREIDAVAAAAAVGQLHARIS 160
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 10954936  161 FLQTTPTVEDAAWLDPKEATYLRWIAVGMTMEEVADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 234
gi 10955045  161 FLRTTPTAEDAAWLDPKEATYLRWIAVGKTMEEIADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 234
gi 10955061  161 FLRTTPTAEDAAWLDPKEATYSDGLPSAR------------------RWRRSLTSKELSTTASASSFAKP---- 212
gi 16119952  161 FLQTTPTVEDAAWLDPKEATYLRWIAVGMTMEEVADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 234
gi 190014846 161 YLRTTPTAEDAAWLDPKEASYLRWIAVGMTMEEIADVEGVKYNSVRVKLREAMKRFDVHSKAHMIALAIRRKLI 234
gi 222109041 161 FLRTSPTAEDAVWLDPKEATYLRWIAVGKTMEEIADVEGVKYNSVRVKLREAMKRFDIRSKAHLTALAIRRKLI 234
gi 222109015 161 FLRITPTAEDAVWLDPKEATYLRWIAVGKTMEEIADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 234
gi 222080291 157 FLRTTPTAEDAAWLDPKEATYLRWIAVGKTMEEIADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRRLI 230
gi 222080193 154 FLRTTPTAEDAAWLDPKEATYLRWIAVGKTMEEIADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 227
gi 222083272 161 FLQTTPTVEDAAWLDPKEATYLRWIAVGMTMEEIADVEGIKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap