Conserved Protein Domain Family
PRK10610

?
PRK10610: PRK10610 
chemotaxis regulatory protein CheY; Provisional
Statistics
?
PSSM-Id: 170568
View PSSM: PRK10610
Aligned: 75 rows
Threshold Bit Score: 242.187
Threshold Setting Gi: 82543638
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157145330   1 MADKELRFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQASGFDFVISDWNMPNMDGLELLKTIRADGAMAS 80 
157371219   1 MADKSLKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGADALNKLRAGDFDFVVSDWNMPNMDGLELLQTIRADGALAS 80 
294504130   1 MADKNLRFLVVDDFSTMRRIVRNLLKELGFHNVEEAEDGVDALNKLRAGGFDFVVSDWNMPNMDGLDLLKTIRTDGALAT 80 
51596720    1 MADKNLRFLVVDDFSTMRRIVRNLLKELGFHNVEEAEDGVDALNKLRAGGFDFVVSDWNMPNMDGLDLLKTIRTDGALAT 80 
153949112   1 MADKNLRFLVVDDFSTMRRIVRNLLKELGFHNVEEAEDGVDALNKLRAGGFDFVVSDWNMPNMDGLDLLKTIRTDGALAT 80 
170023997   1 MADKNLRFLVVDDFSTMRRIVRNLLKELGFHNVEEAEDGVDALNKLRAGGFDFVVSDWNMPNMDGLDLLKTIRTDGALAT 80 
186895782   1 MADKNLRFLVVDDFSTMRRIVRNLLKELGFHNVEEAEDGVDALNKLRAGGFDFVVSDWNMPNMDGLDLLKTIRTDGALAT 80 
123442797   1 MADKNLRFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLRTGGFDFVVSDWNMPNMDGLDLLKTIRADGALGT 80 
253990159   1 MANKDLRFLVVDDFSTMRRIVRNLLKELGFNNVEEAQDGSEALTKIRSSQFDFIISDWNMPNMDGLELLKIIREDAQLAK 80 
50120628    1 MADKELRFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGSDALNKLRSGAFDFVISDWNMPNMDGLELLQTIRADGALSK 80 
157145330  81 LPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM 129
157371219  81 MPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM 129
294504130  81 LPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM 129
51596720   81 LPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM 129
153949112  81 LPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM 129
170023997  81 LPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM 129
186895782  81 LPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM 129
123442797  81 LPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM 129
253990159  81 IPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGL 129
50120628   81 LPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLSKIFEKLGM 129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap