1SUL


Conserved Protein Domain Family
GTPase_YsxC

?
TIGR03598: GTPase_YsxC (this model, PSSM-Id:163346 is obsolete and has been replaced by 274670)
Click on image for an interactive view with Cn3D
ribosome biogenesis GTP-binding protein YsxC/EngB
Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Statistics
?
PSSM-Id: 163346
View PSSM: TIGR03598
Aligned: 89 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 7-Feb-2010
Updated: 19-Feb-2010
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SUL_A         6 SEIVISAVKPEQYPEGGLPEIALAGRSNVGK------------SSFINSLINRKNLARTSSKPGKTQTLNFYIINDELHF 73
gi 71894660    2 fKFVKSSSDYTNWYFHKNSEIAFWGRSNVGK------------SSLLNALT-SKGLAKVSKTPGRTQLINFFENELNQVY 68
gi 42522382   14 iqFIKSAVLEKDFPVHKKAEVAIAGRSNAGK------------SSFINALTKNK-IAKVSSTPGKTRLLNFFELDQSYVM 80
gi 168308581   2 AKFIKSAHYFDQYPIDKQFEICVIGRSNVGK------------SSLINALAN-KKIARTSNTPGRTQLVNFFDFNN-FRL 67
gi 26553493    2 pSFIKSCFSSNDWITDDKKEICFIGRSNVGK------------SSLINALANAK-IAKTSNTPGRTQLANFYD-FDKFRL 67
gi 12045192    3 AHFLKSASDLKDCPQDNIPEICFMGRSNVGK------------SSLINAFFK-KKLAKTSATPGRTQLLNYFEYKDK-RF 68
gi 39938503    5 ATFVRSIVHFKDIPLKKQPEIVLMGRSNVGK------------STFINALTQRKKLAKISQTPGKTITLNYYDINESFYL 72
gi 15828710    2 lHFIKSASNSQSWYNHDKVEICFIGRSNVGKsslinslsnsavS-------------KVSNTPGRTQLINFFEDDQKNVY 68
gi 31544773    5 NRFIKSATSLKDCINDSKKEVCLIGRSNVGK------------STIINGLANAK-IAQTSKTPGRTVTMNFYEIS-NQRI 70
gi 24212844   16 VEFKASYGKADQIPSQGTPQIAFAGRSNAGK------------SSLLNAILERKSLAKVSSTPGKTKLLNFFFVNHSIYL 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SUL_A        74 VDVPGYGFAKVSKSEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYGIPVIVIATKADKIPKGKWD 153
gi 71894660   69 VDLPGYGYAKLSKDLKDKMMAMIEEYLLNRSNLKMLYLLIDSRLGFTKIDLEILSFLKENNLNYFIVFTKIDKLNTKEKN 148
gi 42522382   81 VDMPGYGFAARSGDEMREWHRMIETYLMNREQLRGLLLVMDIRRSWTEDEELLKEFSERRGFPLAVVLTKADKMSRSQML 160
gi 168308581  68 VDLPGYGFAKVSKEKQTDLAAIIDQYLGYRQNLCAVFQICDINV-LTNDDVEMSRYFENQKYAHFVVLNKLDKVNKSYFN 146
gi 26553493   68 IDLPGYGYAKVSKSKHFELSKIISEYIYLRKNLVAVFQIIDISV-ITDLDLQMSELLSNRFNQHYIVLNKADKEAKSYFD 146
gi 12045192   69 VDLPGYGFAKINKNKKDFITNLLTQFLNFRSNLVGVVLIVDSGV-VTVQDQEVVKIILQTGLNFLIVANKFDKLNQSERY 147
gi 39938503   73 IDTPGYGYAKKSKEIQKQLLPMIISFLEQTSHLKAVFQLIDFKVGATQEDDRIHQALLQAGFEVVLLFVKKDKVKKNLVP 152
gi 15828710   69 VDLPGYGFAQMPKDKLEKMHQMIDEYLQNRKNLKTIVLLFDSRRGILDQDLDFINWAQQAKKNIILLATKIDKLNQAQKH 148
gi 31544773   71 VDLPGYGYARIKKSQKEEISLFLSDYLNHRKNLVGIFLILDLGV-ITDQDIEIVRLLTTLDVEYYIVFNKIDKYPKSAYI 149
gi 24212844   84 VDLPGFGYSANSHKDHEAMMGLLMDYLNLAKDLKCLFLVCDSQRELPEEELELIGTCFERNIKPVLVRTKIDKLNQSDLS 163
                        170       180       190
                 ....*....|....*....|....*....|...
1SUL_A       154 KHAKVVRQ--TLNIDPED-ELILFSSETKKGKD 183
gi 71894660  149 ELNKKIKT--YLEKESFN--YLIVSSETKYQID 177
gi 42522382  161 QAVAKVKK--ASGLSA----VFGVSALKKEGQD 187
gi 168308581 147 NNKHKIAK--FLNISTD--RLLCVSAQNNINII 175
gi 26553493  147 NNFAKIAA--KLKKDKEN--IVCVSAKNKTNIP 175
gi 12045192  148 FSLKNIAN--FLKVNFD--KCVFASTKTHHNLA 176
gi 39938503  153 KQLKMLVN--HFPQ---IkYFFLISSKQQEGLE 180
gi 15828710  149 KLLVSLKE---LNLEK---SVLLVSSLKRTNID 175
gi 31544773  150 NNKEKILD--ALKVN-Ed-RILLISAKNKQNLN 178
gi 24212844  164 KLRKKMKNihELYPMl---ETVLVSNKSGKGLP 193
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap