Conserved Protein Domain Family
III_secr_YscJ

?
TIGR02544: III_secr_YscJ (this model, PSSM-Id:162912 is obsolete and has been replaced by 274190)
type III secretion apparatus lipoprotein, YscJ/HrcJ family
All members of this protein family are predicted lipoproteins with a conserved Cys near the N-terminus for cleavage and modification, and are part of known or predicted type III secretion systems. Members are found in both plant and animal pathogens, including the obligately intracellular chlamydial species and (non-pathogenic) root nodule bacteria. The most closely related proteins outside this family are examples of the flagellar M-ring protein FliF [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].
Statistics
?
PSSM-Id: 162912
View PSSM: TIGR02544
Aligned: 16 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 11-Sep-2012
Updated: 15-Oct-2012
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46399480  16 LRQFFLLITLMGLVTSCESRRviVNGLEEKEANEILVFLSNKGINANKvqavsEGGGGAKgvlWNISVEEGQANEAMALL 95
gi 33568209  13 GAGWAALALALALLAGCGARVelLGAAPENEANEVLAALLEAGIAAQK------QSGKAG---YAVSVPAEAVARSLEIL 83
gi 28394252  16 RAARALLAGLLVLLAGCQKEl--YSGLSERDANQMVAVLGDAGISASKdndarDTSDRNA---WLVSVADGDMQAALTVL 90
gi 462305     3 APRCLVVLLVALLLSACSQQL--YSGLTENDANDMLEVLLHAGVDASKv----TPDDGKT---WAVNAPHDQVSYSLEVL 73
gi 46447679  14 WRNVALAALLLVLLTGCKAEl--YKGLNEEQANTMLATLLKRGIEVDK-----QSEGKNG---YTLSVERRQVVQALEVL 83
gi 51587956   4 LRQMLAIVLMTLSLSGCDMEl--YSGLSEGEANQMLALLMLHQINAEK------QIEKSGm--VGLTVDKRQFINAVELL 73
gi 34103898   3 ALRRLWPLLILMSLMGCKVDl--YSGLSEDEANQMLALLMLRNVDAEK------KIIKEGn--VTVRVEKEQFTDAVEVL 72
gi 3024642    3 VHRIVFLTVLTFFLTACDVDL--YRSLPEDEANQMLALLMQHHIDAEK------KQEEDG---VTLRVEQSQFINAVELL 71
gi 1172615    2 IRRYLYTFLLVMTLAGCKDKDl-LKGLDQEQANEVIAVLQMHNIEANK-----IDSGKLG---YSITVAEPDFTAAVYWI 72
gi 2497731    2 IRYKGFILFLLLMLIGCEQREelISNLSQRQANEIISVLERHNITARK-----VDGGKQG---ISVQVEKGTFASAVDLM 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46399480  96 NQVGLPRRRGQNLLGIFANTSLVPSGMQEKIRYQAGLAEQIASTIRKIDGVLDADVQISFPDEDplNPNAPKQKITASVY 175
gi 33568209  84 RASGLPREQFDGMGRIFRKEGLVSSPLEERARYIYALSQELADTLSQIDGVLSARVHVVLPERG--AVGEPATPSTAGVF 161
gi 28394252  91 QANGLPKPSYASLGELFQKQGLVSTPAEERVRYLYGVSQDLSRTLQDIEGVVVARVQVVIPEND--PLADKIKPSSAAVY 168
gi 462305    74 RAHGLPHERHANLGEMFKKDGLISTPTEERVRFIYGVSQQLSQTLSNIDGVISADVEIVLPNND--PLSTSVKPSSAAVF 151
gi 46447679  84 RENSLPREQYQSLGKVFSGDGMIASPSEEKARLSYAISQELADTFSRIDGVLTARAHVVLASSD--VGTDTRTPASAAVF 161
gi 51587956  74 RQNGFPRQRFITVDELFPANQLVTSPTQEQAKMVFLKEQQLENMLSHMDGVIHADVTVAMPMS---VDGKNPLPHTASVF 150
gi 34103898  73 RQHGLPSKRTETMADLFPSGQLVTSPAQEQAKIGYLKEQLLEKMLRGMDGVISAQVSIAESVS---QNRREAPAPSASVF 149
gi 3024642   72 RLNGYPHRQFTTADKMFPANQLVVSPQEEQQKINFLKEQRIEGMLSQMEGVINAKVTIALPTY---DEGSNASPSSVAVF 148
gi 1172615   73 KTYQLPPRPRVEIAQMFPADSLVSSPRAEKARLYSAIEQRLEQSLQTMEGVLSARVHISYDIDAg-ENGRPPKPVHLSAL 151
gi 2497731   74 RMYDLPNPERVDISQMFPTDSLVSSPRAEKARLYSAIEQRLEQSLVSIGGVISAKIHVSYDLE---EKNISSKPMHISVI 150
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*.
gi 46399480 176 VKHNGVLDDPNahLITRIKRLVAGSINGLDYDYVTVIGDKARYGDS 221
gi 33568209 162 LKYRDGQSLDA--LVPEIRKLVTHAIPGLAEDRVSVALVVAQPVQA 205
gi 28394252 169 IRYRPGVDLRA--MAPMVKDLVAHSIEGLQYDNVSLFLQPAAARAT 212
gi 462305   152 IKFRVGSDLTS--LVPNIKTLVMHSVEGLTYENVSVTLVPGGAESD 195
gi 46447679 162 LRHTEDSPVVN--LIPKIREMTAKAVPGLDYEKVSVMLVPVRESVT 205
gi 51587956 151 IKYSPEVNLQS--YQSQIKGLVRDAVPGIDYAKISVVMQPANYRFS 194
gi 34103898 150 IKYSPGINMQS--RETDIKRLIHTGVPNLRSENISVVLQAADYRYR 193
gi 3024642  149 IKYSPQVNMEA--FRVKIKDLIEMSIPGLQYSKISILMQPAEFRMV 192
gi 1172615  152 AVYERGSPLAH--QISDIKRFLKNSFADVDYDNISVVLSERSDAQL 195
gi 2497731  151 AIYDSPKESEL--LVSNIKRFLKNTFSDVKYENISVILTPKEEYVY 194
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap