Conserved Protein Domain Family
FliA_WhiG

?
TIGR02479: FliA_WhiG (this model, PSSM-Id:162877 is obsolete and has been replaced by 274153)
RNA polymerase sigma factor, FliA/WhiG family
Most members of this family are the flagellar operon sigma factor FliA, controlling transcription of bacterial flagellar genes by RNA polymerase. An exception is the sigma factor WhiG in the genus Streptomyces, involved in the production of sporulating aerial mycelium.
Statistics
?
PSSM-Id: 162877
View PSSM: TIGR02479
Aligned: 20 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 11-Sep-2012
Updated: 15-Oct-2012
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 133480    50 LILHYSPLVKYVAGRVSVGLPPNVEQADFVSSGVFGLIDAIEKFDVDREIKFETYAITRIRGAMIDELRALDWIPRSVRQ 129
gi 34483673  21 LAVSYLPAVKAMAYRLKERLPSSIDTADLVSIGAEELIKLSRRYNEALNDSFWGFAKTRVQGAMLDYLRSLDVVSRGNRK 100
gi 46451054  39 IVRHYAPKIRFLALRLKAKLPRNVELGELISAGTLGLMEALGKFKPQLGIRFETYAESRIRGAMLDELRRLDWFPRSLRQ 118
gi 52427731  14 VLTQYAPLVRRLGLQLVAKMPASVDLDDLIQAGMIGLLDAASRYKEDQGAQFETYATQRIRGAMLDELRSNDWLPRSLRK 93
gi 6952813   20 FIERYSVLVKRIAHHLLGRLPPSVQVEDLIQAGMIGLIEAQQNYDGSKGASFETYAGIRIRGAMLDDMRKGDWVPRSVHK 99
gi 4378867   25 LIKTHLQLVRKIAWHVHGRVSSAIEVEDLIQIGMVALIEAANAFE-NRGFAFATYASMRIRGAMIDYMRQHAATARSSIA 103
gi 46911704  31 LVNKHASLVKRVVRHLTAQVTTVMSLEDMEQIGLMALLDVIRRYSDENDASLERLAVQRIRGAILDELRRMDWRSRRSRQ 110
gi 417236    28 LLQRHQVMVKRVVNQLRVHATSHCSIEDMQQIGLIALVEAGRRYGDIDDTHFPAFAVCRVRGAILDELRRLDWRSRKTRQ 107
gi 34104300  18 HLAVYAPLVKRAARQLSSQAGGVFDREDMEQIGLMALLDCLRRYGGEPDERFAGFAMLRIRGAILDELRRLDWRPRSVRQ 97
gi 22758825  22 ILTRYLPLVKRAASHLRSQVSACFDQEDMEQVGMMGLLEAWRRYDSEPDPQFESYAFKRIRGAMLDELRRLDWRPRQLRQ 101
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 133480   130 KARNVERAYATLEARLRRTPSESEVAVEMGIAVEDLHAVFsqLSLANVVALEELLHAGGEGggrlslmdtledtaADNPV 209
gi 34483673 101 LIKQIDVEISHYMNEHSSEPSDEYLAEVLGEDIKKIREAK--IASDIYVLMPIEDQLSALH--------------EEATE 164
gi 46451054 119 RVRQLDEAMQRIEHETGRRATEEDLQKATGLDEKDVRLGLeaLQNQLCLSLEAMQDSLAGEggp---------qsDADPM 189
gi 52427731  94 TSREVEHAVHQVEQRLGRSANETEIAAHLQMPLDEYQSMLqdLHGSQLVYYEDFDRSADDEpfldr----yradhS-DPL 168
gi 6952813  100 NNREINQAVAELEGVLNRDPTDSEVAAHLGMSLDQYHSALtdINCSRLVGIEDLGVSDDVIspad------etddS-NPF 172
gi 4378867  104 RQKTLNKAREELSATLGRRPEDAEIAEKLNMSPSEYREWAdgAINIRQESLDDVYSDHSSift----------ddNADQA 173
gi 46911704 111 KSHELRDTERALGRQLGRMPTDQEVAAELDIELGDVKQRRvdTQAESLTSMDALQEDG-EQffg-----------lsFQC 178
gi 417236   108 QAHELNDVTRDLTRSLGRMPTDSEIIKALGTDEQDYYNRQnaALAGEMQSLDQLMENSTDShf-------------ggQY 174
gi 34104300  98 EAHRVRDGLRELRRKLRREPTEAEALGLLGLDADAYRDALlaENAEAMASFDELVASGMELaa---------------eg 162
gi 22758825 102 QVHSHNQAQRELYNRLGRAPTEQELAVSLNCTVEEVRQLAyaSQAEALQSLEEWLENGGKApa----------------- 164
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 133480   210 EVAEDRELRRLLARAINTLPEREKTVVTLYYYEGLTLAEIGNVLGVTESRVSQIHTKSVLQLRAKLA 276
gi 34483673 165 GRIEQEELVGIISEILESLSEREQLIIQLYYFEELNLKEISEVLEITESRISQIHKEVIKKIRERLG 231
gi 46451054 190 QTAATQELIERVASLIDELTPREKLVLSLYYSDELNMRETAEVMGITEGRVSQLHSQALGRLRREFR 256
gi 52427731 169 SALLDEHLRSALVDAIERLPEREKLLMSLYYERGLNLREIGAVLEVSESRVCQLHSQAVARLRAKLR 235
gi 6952813  173 KGVADESFRKALVESIKQLPEREALVLSLYYDEELNLKEIGDVLGVSESRVSQILSQAMQRLRTKLS 239
gi 4378867  174 SEMEREALQSALAEQIKTLPEREALVLQLYYVEELNLKEIGEVLDLGTARISQIKKSAVDHLRQKMT 240
gi 46911704 179 NSYERVALKKAMAQALARLSKREQVMLSFYYEHEMNLKEIGLVFELTEARVSQIHKKALKSLNSMLT 245
gi 417236   175 DGMEHEHIRRSLDSALGRLSKRDQLLLTLFYQHELNLHEIALVLDLTPPRICQLHKQALKQLNQLMS 241
gi 34104300 163 TPEARLERQSELARALTALNEREQQVIQLYYEFELSLKEIAAVLELTEARICQINKSALKKMQACLM 229
gi 22758825 165 teSDDVDMAMTISKVLTSLDKREQLLLSLYYQQELNMKEIALVLGLTESRVCQLHKQCVLQLKQRLV 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap