Conserved Protein Domain Family
rpoH_proteo

?
TIGR02392: rpoH_proteo (this model, PSSM-Id:162835 is obsolete and has been replaced by 274107)
alternative sigma factor RpoH
A sigma factor is a DNA-binding protein protein that binds to the DNA-directed RNA polymerase core to produce the holoenzyme capable of initiating transcription at specific sites. Different sigma factors act in vegetative growth, heat shock, extracytoplasmic functions (ECF), etc. This model represents the clade of sigma factors called RpoH and further restricted to the Proteobacteria. This protein may be called sigma-32, sigma factor H, heat shock sigma factor, and alternative sigma factor RpoH. Note that in some species the single locus rpoH may be replaced by two or more differentially regulated stress response sigma factors.
Statistics
?
PSSM-Id: 162835
View PSSM: TIGR02392
Aligned: 18 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 2-Mar-2011
Updated: 7-Mar-2011
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33577933   38 GTIDAYISAVNRLPILTAEQEGQLARRLRDEGDLEAARELVVSHLRLVVSVARQYLGYGLPHADLIQEGNVGLMKAVKRF 117
gi 30180193   13 GDLDSYIRATSSFPVLSREEEASLAKRMREEGDVNAAHQLVLSHLRVVVTIARGYLGYGLPHADLIQEGNIGLMKAVRRF 92
gi 24351072   17 SSLEAYIHSVTSMNMLDAETEYELAKRLQETGDLQAAKQLIMSHLRFVVHVAKGYAGYGLPQADLIQEGNIGLMKAVKRF 96
gi 33504408   15 GTLEAYIRAANLYPMLTVEEEQKLAKNLYYNGDLNAAKKLIVSHLRFVIHVARNYSGYGLSQADLIQEGNIGLMKSIRRF 94
gi 23348506   14 GGLTRYLEEIRRFPMLEPQEEYMLAKRYHEHADPKAAHKLVTSHLRLVAKIAMGYRGYGLPIGEVISEGNVGLMQAVKRF 93
gi 1613784    14 AGLSKYLVEIRKFPLLTPEQELAYARRWREHRDRDAAYHLVTSHLRLVAKIAMRYRGYGLPIAEIVSEGNIGLMQAVRRF 93
gi 1834377    23 PFLSAYSAAIRRYELLEPGQEQQLARRWHETRDRGAADALVTSHLRLAAKLARGYKGYGLPMVDLIAEANLGLVIAASRF 102
gi 53718144   37 GNIDAYIQAVNRIPLLSAEEERQYATEYREQNNLDAARRLVLSHLRLVVSVARNYLGYGLPHGDLIQEGNIGLMKAVKRF 116
gi 198284457  15 DGLAGYLRFVNAQPLLRPEEERDLARRLRDHGDVDAAKDLVLSHLRFVVRVARGYRGYGLQEADLIQEGNIGLMKAVKRY 94
gi 15676610   18 GSLEQYIHTVNRIPMLTQEEETRLAER-QHKGDLNAAKQLILSHLRVVVSIARGYDGYGLNQADLIQEGNIGLMKAVKRY 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33577933  118 DPERGVRLVSFAVHWIKAEIHEFIIRNWRLVKVATTKAQRKLFFNLRSMRP---DGQ-T-LDPEQVDHIARELNVRREDV 192
gi 30180193   93 DPERGVRLISFAIHWIRAEIHEFIMRNWRLVKIATTKQQRKLFFNLRSMKK---GLD-T-MSQAEVASMAEQLGVKAEEV 167
gi 24351072   97 DPDVGVRLVSFAVHWIKAEIHEYVLKNWRIVKVATTKAQRKLFFNIRKAKT---RL--GwFSDDEVTMVAENLGVSKADV 171
gi 33504408   95 NPELDVRLVSFAVHWIKSEIHEYVLKNWRIVKIATTKAQRKLFFNLRKTKQ---RL--GwFNEGEIEMVAKTLHVTCKDV 169
gi 23348506   94 EPERGFRLATYAMWWIKASIQEYILRSWSLVKMGTTANQKRLFFNLRKMKSkiqALDdGdLNPDQVKQIATKLNVSEDEV 173
gi 1613784    94 DPDRGVRLATYAMWWIRASIQEYILRSWSLVKIAASASQKKLFFKLRRAKSaisALQdGdLRPEQVRLIAERLKVAERDV 173
gi 1834377   103 EPGRGARFSTYAIWWIKAAIHEYILRSWSLVKIGTTAAQKKLFFKLRSEIRkatGSVmSgLTPDVAELIAGKLDVTAREV 182
gi 53718144  117 DPAQNVRLVSYAIHWIKAEIHEYILRNWRMVKVATTKAQRKLFFNLRSHKK---GTQ-A-FTPEEIDGLAQELNVKREEV 191
gi 198284457  95 DPDHGVRLVSFAVHWVKAEIHEFILRNWRIVKVATTKAQRKLFFNLRSSRS---HT--GwMSGEESAAMADDLGVTQAQV 169
gi 15676610   97 EPGRGARLFSFAVHWIKAEIHEFILRNWRLVRVATTKPQRKLFFNLRSMRK---NLN-A-LSPKEAQDIADDLGVKLSEV 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33577933  193 SEMEVRLSGRDLSLESQDDD-DDSf---APIAYLSDEgrqEPSRVLDRMAHDDLQGAGLGRALEALDARSRRIIEARWLQ 268
gi 30180193  168 VEMETRFSGRDISLEPVTDSdEDDf---SPIAWLTDGs--DPSRELEKEQLERLTHARLKNSLDSLDERSRRIIEARWLR 242
gi 24351072  172 TEMESRMAAQDPAFDLSSDNdDeh--dfAPVHYLEDHs-sDLAENIENDNWESNAQGRLLSAIKTLDERSQHILRARWLD 248
gi 33504408  170 REMESRMAAQDMTLEQPYLDeDDKnilsIPMLYLQDKi-tIIDD---EEEWIDQVSNKLNIALNTLDKRSQHIIRARWLN 245
gi 23348506  174 VSMNRRLSG-DASLNAPLRAsEGEs--gEWQDWLVDDs-nSQEQVLIEQDELESRRSMLEQAMETLNDRERRIFEARRLA 249
gi 1613784   174 VAMDRRLRG-DASLNVPIHD-EDEg--gQTLDWLVDPa-pTCEITLAEEQEAKQRRLALANALANLNARERNIFTARWLN 248
gi 1834377   183 IEMDARLNG-DMSLNARVGG-EESg--tELEALLVDGa-vDAETMLADHEQTERRAKALRVALGGLAARERHVFEARRLT 257
gi 53718144  192 AEMETRLSGGDIALEGQIDDgEESy---APIAYLADSh-nEPTAVLAARQRDMLQTDGIARALESLDARSRRIIEARWLN 267
gi 198284457 170 LEMEGRMSGYDYSLNLEPDEeREGg--rAP--DLADPt-gSPIEQLVERDWDQQQHRALHTALSALPQRDRYIIENRWLS 244
gi 15676610  172 LEMEQRMTGHDIAIMADNSDdEDSf---APIDWLADHd-sEPSRQLSKQAHYALQTEGLQNALAQLDDRSRRIVESRWLQ 247
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 33577933  269 -DDg----GLTLHELAQEFGVSAERVRQIEAAALKKMRGALTP 306
gi 30180193  243 -EDk----AATLHELADELGVSAERVRQIEAKAMKKMRAEIAI 280
gi 24351072  249 -DD-----KTTLQELAETYQVSAERIRQLEKNAMNKLKACMEA 285
gi 33504408  246 aDN-----KTTLQELANQYGISAERIRQLEKNAMKKMKLILNN 283
gi 23348506  250 -EE-----PMTLEDLSGEFGISRERVRQIEVRAFEKVQAAVKA 286
gi 1613784   249 -EE-----STTLEELAAEYGVSRERVRQIEERAFQKVKAAMLT 285
gi 1834377   258 -EC-----PVTLDQLARELSISSERVRQIEIRAFAKVKRAVML 294
gi 53718144  268 -VDddgsgGSTLHDLAAEFGVSAERIRQIEASAMKKMRTALAA 309
gi 198284457 245 -DD-----PKTLQVLGDELGVSAERVRQLEKSSMGKLRQQMLT 281
gi 15676610  248 -DDg----GLTLHQLAAEYGVSAERIRQIEAKAMQKLRGFLTe 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap