Conserved Protein Domain Family
MenG_MenH_UbiE

?
TIGR01934: MenG_MenH_UbiE (this model, PSSM-Id:162613 is obsolete and has been replaced by 273884)
ubiquinone/menaquinone biosynthesis methyltransferases
Note that a number of non-orthologous genes which are members of pfam03737 have been erroneously annotated as MenG methyltransferases.
Statistics
?
PSSM-Id: 162613
View PSSM: TIGR01934
Aligned: 16 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 5-Feb-2010
Updated: 19-Feb-2010
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7416776   51 IRRVFSAVAARYDLMNDLMSFGIHRLWKRRFVRMAAPq--AGQHIVDLAGGTGDVA---ALMAaad---rrVTVVDPSAE 122
gi 21542473  20 INNIFSRVADKYDLMNDLMSIGLHRLWKDEFIMQIPN---LNSNILDVASGSGDIAlklAKKAkdrgnnisLILSDINEE 96
gi 17380538  25 VAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSGVr--RGQTVLDLAGGTGDLTakfSRLVget---gkVVLADINES 99
gi 13093910  21 VVAMFDDVAHRYDLTNTVLSLGQDRYWRRATRSALRIg--PGQKVLDLAAGTAVSTaelSKSGa------wCVAADFSVR 92
gi 15924461  11 VHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVr--KGTKALDVCCGTGDWTialSKAVgpt---geVTGIDFSEN 85
gi 34540725  20 VEAMFNHIAGHYDRLNHLFSWGMDRVWRQKAIRMIEPf--APHTVLDVATGTGDLAieiCRHIpsv---kqVTGVDLSLE 94
gi 15807395  19 VQEMFASIAPRYDLLNRVLSLGVDRGWRRAAAAEALAh--SPRRVLDVATGTGDFAielKERApq----veIVGSDFVPQ 92
gi 16329425  14 VQQIFARIAPQYDDLNTFLSFGQHHIWKAMAVKWSGVs--PGDRLLDVCCGSGDLAfqgAKVVgtr---gkVVGLDFCAE 88
gi 19704875  10 VHEVFENIHTQYDRANNKISFGLQKNWKQELVDKIVEetpKNSDFLDVCCGTGDISiwlAKKRed----lnIIGVDFSSA 85
gi 15605155  10 IQIMFDSLAPTYDKINGILSLGLHIAWNNALVSLLGE----TNHLLDLCAGTGRVAlsyVQNYpr----asATLVDFSTK 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7416776  123 MMAVGQAR--G-----HahVDWQVGSAEQLPLADASVDTLTISFGIRNATRIDVALREIHRVLKPGGRFLCLEFSTPAW- 194
gi 21542473  97 MLNNAKKK--SidlnlFqnIKFIVANAEELPFSDNSFDYYTIAFGIRNVPDINKALKEAYRVLKPMGKFVCLEFSKVKE- 173
gi 17380538 100 MLKMGREK--LrnigvIgnVEYVQANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPII- 176
gi 13093910  93 MLATGGAR--K--------VPKVAADATQLPFSDGVFDAVTISFGLRNIADYQAALREMARVTRPGGQLVVCEFSTPTN- 161
gi 15924461  86 MLEVGKEK--Ta---sMenVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMNRVLKPGGMVVCLETSQPTL- 159
gi 34540725  95 MMRIGEQKvrSen--lDnrITFMQKDCLDLPFADHSFDAVTVAFGLRNFQNIKLGLEEMYRVLNEGAPLMILELSRPVS- 171
gi 15807395  93 MLDLARQK--Aga--kQlsIRFEEGDALRLPYPDASFDAVTCAFGFRNFADYTQGLAEMWRVLTPGGRLVLLEFPPPAS- 167
gi 16329425  89 LLAIAAGK--HkskyaHlpMQWLQGDALALPFSDNEFDGATMGYGLRNVGNIPQALTELQRVLKPGKKVAILDFHQPGN- 165
gi 19704875  86 MLNEAVKK--Skn----lnIVWKEADALCLPFKDSSFSAVAISFGLRNTVDYEKVLKEMIRVVKKDGFIYCLDSFVPDC- 158
gi 15605155  82 MLENVQKR--Hps----apFSYITSDVTHLPLPDNTFRLASMAYGLRNLSYPLEALREVYRVLQPGGHLGILELTRPATy 155
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 7416776  195 W-LRPFYNLFSFTVIPRLGAWIANSPEAYTYLVESIRRFPDQRGFAAMISAAGFESVRWHDLSFGIACVHVGTR 267
gi 21542473 174 GiLKDFYKFYSFNIIPSIGQIIAGNKEAYEYLVESIALFPSQDDFRIMIKESGFEEVHYKNLSGGIVAIHSAYK 247
gi 17380538 177 EpLSKAYDAYSFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTAGVVALHRGYK 250
gi 13093910 162 AlVANVYTEYLMRALPQVARLVSSNPDAYIYLAESIRAWPDQVTLACQLSRTGWASPRWRNLTGGIVALHAADK 235
gi 15924461 160 PvFKQMYALYFKFVMPIFGKLFAKSKEEYEWLQQSTFNFPGKEELKRMFEEAGFINVRVRSFTGGVAAMHLGYK 233
gi 34540725 172 FpWKQGYNFYASHVIPVVGRFLSQDAEAYTYLPESIAAMPQREELADLMLSVGFREAYYRSLSLEVATVYMGLK 245
gi 15807395 168 GlFGAVFRLYFQHVLPRIGALVSGNAGAYTYLPESVLAFPEPERLAQMMRATGFRT-RYRALTFGIAGMWVGDK 240
gi 16329425 166 AlAANFQRWYLANVVVPMAKQWR-LTEEYAYLQPSLDRFPTGPKQVQFALEVGFAKAVHYPIAAGLMGVLVAEK 238
gi 19704875 159 LwIQPFYKMYFKYIMPLFGGG-KKYYKEYVWLYESTQQFLKKKELILLYEKLGLKEIKHCSKMFGVCVMIQGKK 231
gi 15605155 156 NpVYLLHKLYLNLVVPSVGRFYSGNSYAYSYLKESIRDLPRDAALEAIFHAAHLRPIRKRKLLFGTATIWILEK 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap