Conserved Protein Domain Family
LIC

?
TIGR00860: LIC (this model, PSSM-Id:162072 is obsolete and has been replaced by 273305)
Cation transporter family protein
The Ligand-gated Ion Channel (LIC) Family of Neurotransmitter Receptors TC 1.A.9)Members of the LIC family of ionotropic neurotransmitter receptors are found only in vertebrate and invertebrate animals. They exhibit receptor specificity for (1)acetylcholine, (2) serotonin, (3) glycine, (4) glutamate and (5) g-aminobutyric acid (GABA). All of these receptor channels are probably hetero- orhomopentameric. The best characterized are the nicotinic acetyl-choline receptors which are pentameric channels of a2bgd subunit composition. All subunits arehomologous. The three dimensional structures of the protein complex in both the open and closed configurations have been solved at 0.9 nm resolution.The channel protein complexes of the LIC family preferentially transport cations or anions depending on the channel (e.g., the acetylcholine receptors are cationselective while glycine receptors are anion selective) [Transport and binding proteins, Cations and iron carrying compounds].
Statistics
?
PSSM-Id: 162072
View PSSM: TIGR00860
Aligned: 21 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 11-Sep-2012
Updated: 15-Oct-2012
Structure
?
Aligned Rows:
TIGR00860 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 120781    1 MWGIiv--pFFSASLMCSLVAVVRCQ----QDTDHFANVT-NTIDSLLKGYDIRLRPS--------FGGAPLEIGIEVIL 65
gi 7159696   3 NSVPlatriGPMLALICTVSTIMSAV----EAKRKLKEQE--IIQRILNNYDWRVRPRglnaswpdTGG-PVLVTVNIYL 75
gi 1401283   2 NSFP----------IVCWNLAFLILV----VAKKKLKEQE--IIQRTLKDYDWRVRPRgnnlswpdTGG-PVLVSVNIYL 64
gi 2506127   3 CSPG-----GVWLALAASLLHVSLQG-----------EFQrKLYKELVKNYNPLERPVa-------nDSQPLTVYFSLSL 59
gi 1703074   3 GS--------LCLALAASILHVSLQG-----------EFQrKLYKDLVKNYNPLERPVa-------nDSLPLTVYFSLSL 56
gi 7025431   3 GRRG-----GIWLALAAALLHVSLQG-----------EFQrRLYKELVKNYNPLERPVa-------nDSQPLTVYFSLSL 59
gi 113067    3 LRAL-----MLWLLAAAGLVRESLQG-----------EFQrKLYKELLKNYNPLERPVa-------nDSQPLTVYFTLSL 59
gi 113107    3 LAVI-----GLFTLFTSIIAITPAREf------VSLAEREdALLRELFQGYQRWVRPVq-------hANHSVKVRFGLKI 64
gi 1168222   5 VQQA-----LLALLLPTLLAQGEAR-----RSRNTTRPALlRLSDYLLTNYRKGVRPVr-------dWRKPTTVSIDVIV 67
gi 2978508   5 LQLA-----LLALLLPTSLAQGEVRGkgtaQAHNSTRPALqRLSDHLLADYRKSVRPVr-------dWRKPTTVSIDAIV 72
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 120781   66 ASFDSISEVDMDYTITMYLNQYWRDERLQFifnesldlgenRSVT-TMTLTgafaEKIWVPDTFLANDKNSFLHDITEKN 144
gi 7159696  76 RSISKIDDVNMEYSAQFTFREEWVDARLAYgrfedestevpPFVVlATSENadqsQQIWMPDTFFQNEKVARRHLIDKPN 155
gi 1401283  65 RSISKIDDVNMEYSAQFTFREEWNDARLGYerladentqvpPFVVlAASEQpdltQQIWMPDTFFQNEKEARRHLIDKPN 144
gi 2506127  60 LQIMDVDEKNQVLTTNIWLQMSWTDHYLQWnvs------eyPGVKtVRFPD----GQIWKPDILLYNSADERFDATFHTN 129
gi 1703074  57 LQIMDVDEKNQVLTTNIWLQMTWTDHYLQWnas------eyPGVKtVRFPD----GQIWKPDILLYNSADERFDATFHTN 126
gi 7025431  60 LQIMDVDEKNQVLTTNIWLQMSWTDHYLQWnms------eyPGVKnVRFPD----GQIWKPDILLYNSADERFDATFHTN 129
gi 113067   60 MQIMDVDEKNQVLTTNIWLQMYWTDHYLQWnvs------eyPGVKnVRFPD----GLIWKPDILLYNSADERFDATFHTN 129
gi 113107   65 SQLVDVDEKNQLMTTNVWLWQEWLDYKLRWnpe------nyGGITsIRVPS----ESIWLPDIVLYENADGRFEGSLMTK 134
gi 1168222  68 YAILNVDEKNQVLTTYIWYRQYWTDEFLQWnpe------dfDNITkLSIPT----DSIWVPDILINEFVDVGKSPNIP-Y 136
gi 2978508  73 YAILSVDEKNQVLTTYIWYRQFWTDEFLQWnpe------dfDNITkLSIPT----DSIWVPDILINEFVDVGKSPNIP-Y 141
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 120781  145 KMVRLYGNGSLVYGMRFTTTLACMMDLHNYPLDHQECTVEIESYGYTMDDIVLYWLNDrGAVTGVEDV--SLPQFSITN- 221
gi 7159696 156 VLIRIHKDGSILYSVRLSLVLSCPMSLEFYPLDRQNCLIDLASYGYTTQDIKYEWKEQ-NPVQQKDGLrqSLPSFELQD- 233
gi 1401283 145 VLIRIHPDGQILYSVRLSLVLSCPMSLEYYPLDRQTCLIDLASYAYTTDDIKYEWKVK-NPIQQKEGLrqSLPSFELQD- 222
gi 2506127 130 VLVNS--SGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGG--WSLDLQMQ----EADISGyiPNGEWDLVGi 201
gi 1703074 127 VLVNS--SGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGG--WSLDLQMQ----EADISGyiPNGEWDLVGv 198
gi 7025431 130 VLVNA--SGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGG--WSLDLQMQ----EADISSyiPNGEWDLMGi 201
gi 113067  130 VLVNS--SGHCQYLPPGIFKSSCYIDVRWFPFDVQKCNLKFGSWTYGG--WSLDLQMQ----EADISGyiSNGEWDLVGi 201
gi 113107  135 AIVRY--NGMITWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGNMVKLVLINQ----QVDRSDffDNGEWEILSa 208
gi 1168222 137 VYIRH--QGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLpEKVKSDRSVfmNQGEWELLGv 214
gi 2978508 142 VYVRH--QGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLpEKVKSDKSVfmNQGEWELLGv 219
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 120781  222 YATINK-IEELSTGDYQRLSLIFQLQRN--IGYFIFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISNG 298
gi 7159696 234 VVTKYC-TSKTNTGEYSCLRTQMVLRRE--FSYYLLQLYIPSFMLVIVSWVSFWLDKDSVPARVTLGVTTLLTMTTQSSG 310
gi 1401283 223 VLTEYC-TSKTNTGEYSCARVLLLLRREyrFSYYLIQLYIPCIMLVVVSWVSFWLDKDAVPARVSLGVTTLLTMTTQASG 301
gi 2506127 202 PGKRSErFYECCKEPYPDVTFTVTMRRR--TLYYGLNLLIPCVLISALALLVFLLPAD-SGEKISLGITVLLSLTVFMLL 278
gi 1703074 199 LGKRSEkFYECCKEPYPDVTFTVSIRRR--TLYYGLNLLIPCVLISALALLVFLLPAD-SGEKISLGITVLLSLTVFMLL 275
gi 7025431 202 PGKRNEkFYECCKEPYPDVTYTVTMRRR--TLYYGLNLLIPCVLISALALLVFLLPAD-SGEKISLGITVLLSLTVFMLL 278
gi 113067  202 PGKRTEsFYECCKEPYPDITFTVTMRRR--TLYYGLNLLIPCVLISALALLVFLLPAD-SGEKISLGITVLLSLTVFMLL 278
gi 113107  209 TGVKGS--RQDSHLSYPYITYSFILKRL--PLFYTLFLIIPCLGLSFLTVLVFYLPSD-EGEKVSLSTSVLVSLTVFLLV 283
gi 1168222 215 LPYFREfS-MESSNYYAEMKFYVVIRRR--PLFYVVSLLLPSIFLMVMDIVGFYLPPN-SGERVSFKITLLLGYSVFLII 290
gi 2978508 220 LTEFLEfSDRESRGSFAEMKFYVVIRRR--PLFYAVTLLLPSIFLMIVDIVGFYLPPD-SGERVSFKITLLLGYSVFLII 296
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 120781  299 VRSSLPRIS-YVKAIDIYLVMCFVFVFAALLEYAAVNYTYWGARAKRK------AKRLRERATSVRKRVDDGdQMNNTNM 371
gi 7159696 311 INANVPPVS-YTKAIDVWIGVCLAFIFGALLEFAWVNYAARK-----D------MSCG-----QRMMKQLPQdGYR-PLA 372
gi 1401283 302 INAKLPPVS-YIKAVDVWIGVCLAFIFGALLEYALVNYHGR------------------------------Qe------- 343
gi 2506127 279 VAEIMPATSdSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKmpk-wtRVILLNWCAWFLRMKRPGeDKVRPAC 357
gi 1703074 276 VAEIMPATSdSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKmpk-wtRVVLLNWCAWFLRMKRPGeDKVRPAC 354
gi 7025431 279 VAEIMPATSdSVPLIAQYFASTMIIVGLSVVVTVIVLRYHHHDPDGGKmpk-wtRIILLNWCAWFLRMKRPGeDKVRPAC 357
gi 113067  279 VAEIMPATSdSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKmpk-wtRVILLNWCAWFLRMKRPGeDKVRPAC 357
gi 113107  284 IEEIIPSSSkVIPLIGEYLLFIMIFVTLSIIVTIFVINVHHRSSATYHpmspwvRSLFLQRLPHLLCMRGNTdRYHYPEL 363
gi 1168222 291 VSDTLPATAiGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPvpa-wlRHLVLERIAWLLCLREQStSQRPPAT 369
gi 2978508 297 VSDTLPATAiGTPLISVYFVVCMALLVISLAETILIVRLVHKQDLQQPvpl-wlRHLVLERIAGLLCLGEQLtSHRGPAT 375
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 120781  372 DTVE----LKEVHMVPTSVGvtns----qsfnLDLD-------------------DGSGDDTGFRVVPPIPRsfthshat 424
gi 7159696 373 GSQP----RTSFCCR----------------------------------------------------------------- 383
gi 1401283     --------------------------------------------------------------------------------
gi 2506127 358 QHKQrrcsLASVEMSAVAPPpasngnllyigfRGLDgvhcvptpdsgvvcgrmacSPTHDEHLLHGGQPPEG-------- 429
gi 1703074 355 QHNErrcsLASVEMSAVAGPpatngnllyigfRGLDtmhcaptpdsgvvcgrvacSPTHDEHLLHAGQPSEG-------- 426
gi 7025431 358 QHKPrrcsLASVELSAGAGPpssngnllyigfRGLEgmhcaptpdsgvvcgrlacSPTHDEHLMHGTHPSDG-------- 429
gi 113067  358 QHKQrrcsLSSMEMNTVSGQqcsngnmlyigfRGLDgvhctpttdsgvicgrmtcSPTEEENLLHSGHPSEG-------- 429
gi 113107  364 EPHS-----PDLKPRNKKGPp------------GPEg---------------------EGQALIN--------------- 390
gi 1168222 370 SQATktddCSAMGNHCSHMGg----------pQDFEk--------------------SPRDRCSPPPPPREA-------- 411
gi 2978508 376 LQATktddFSAMGNHCGPLGg----------pQDLEk--------------------TSRGRGSPPPPPREA-------- 417
                      490       500       510       520       530       540       550
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 120781  425 thgyiptnvvrRRSSSHVPPRRRrllshFRQKAKSIKVKIPRVQDVNTIDKYARLMFPLLFIIFNTSYWSVY 496
gi 7159696 384 ------------------------------------IFVRRHKERSKRIDVVSRLVFPIGYACFNVLYWAVY 419
gi 1401283 344 -------------------------------------FLKKEKKK--------------------------- 351
gi 2506127 430 -----------DPDLAKILEEVRyianrFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSA 490
gi 1703074 427 -----------DPDLAKILEEVRyiahrFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTILCTIGILMSA 487
gi 7025431 430 -----------DPDLAKILEEVRyianrFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTIICTIGILMSA 490
gi 113067  430 -----------DPDLAKILEEVRyianrFRDQDEEEAICNEWKFAASVVDRLCLMAFSVFTIICTIGILMSA 490
gi 113107  391 -------------LLEQATNSVRyisrhIKKEHFIREVVQDWKFVAQVLDRIFLWTFLTVSVLGTILIFTPA 449
gi 1168222 412 -----------SLAVCGLLQELSsirqfLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLW 472
gi 2978508 418 -----------SLAMCGLLQELAsirhfLEKREETREVARDWLRVGSVLDKLLFRVYLLAVLAYSITLVTLW 478
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap