1HN9,3IL3,1M1M


Conserved Protein Domain Family
fabH

?
TIGR00747: fabH (this model, PSSM-Id:162020 is obsolete and has been replaced by 273249)
Click on image for an interactive view with Cn3D
3-oxoacyl-(acyl-carrier-protein) synthase III
FabH in general initiate elongation in type II fatty acid synthase systems found in bacteria and plants. The two members of this subfamily from Bacillus subtilis differ from each other, and from FabH from E. coli, in acyl group specificity. Active site residues include Cys112, His244 and Asn274 of E. coli FabH. Cys-112 is the site of acyl group attachment [Fatty acid and phospholipid metabolism, Biosynthesis].
Statistics
?
PSSM-Id: 162020
View PSSM: TIGR00747
Aligned: 11 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 11-Sep-2012
Updated: 15-Oct-2012
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1HN9_A   1 MYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAATRAIEMAGIEKDQIGLIVVAT 80  Escherichia coli E24377A
O34746   1 MKAGILGVGRYIPEKVLTNHDLEKMVETSDEWIRTRTGIEERRIAADDVFSSHMAVAAAKNALEQAEVAAEDLDMILVAT 80  Bacillus subtilis sub...
O84242   1 MRASIWGTGSYLPKKILTNADLEKIVETSDEWISTRTGIKERRIASAEEFSSFMGAKAAEKAIEAAKISKSQVDCIVFST 80  Chlamydia trachomatis...
P24249   1 MYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAATRAIEMAGIEKDQIGLIVVAT 80  Escherichia coli
P43711   1 MNSRILSTGSYLPSHIRTNADLEKMVDTSDEWIVTRSGIRERRIAAEDETVATMGFEAAKNAIEAAQINPQDIELIIVAT 80  Haemophilus influenza...
O24994   3 FYASLKSIAMHVPSERVKNAEFQQFLDTSDEWIEKRTGIKERRFANDEEKSSDLGVIAAKQAIERAHLTPKDIDLVVVAT 82  Helicobacter pylori 2...
Q9ZCH1   1 MTCKIIGSGGYLPPKIISNDELTKFVDTNDKWIRTRTGILQRHIAGDAEYTSHLAFKSAQKAIEDAMISVDDIDLIIICT 80  Rickettsia prowazekii...
O06399  11 RSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADDESAASMATEACRRALSNAGLSAADIDGVIVTT 90  Mycobacterium tubercu...
Q9Z8P0   9 KKAAIWATGSYLPEKVLSNADLEKMVDTSDEWIVTRTGIKERRIAGPQEYTSLMGAIAAEKAIANAGLSKDQIDCIIFST 88  Chlamydia pneumoniae
3IL3_A   8 MNSRILSTGSYLPSHIRTNADLEKMVDTSDEWIVTRSGIRERRIAAEDETVATMGFEAAKNAIEAAQINPQDIELIIVAT 87  Haemophilus influenzae
1M1M_A  31 RSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADDESAASMATEACRRALSNAGLSAADIDGVIVTT 110 Mycobacterium tubercu...
1HN9_A  81 TSATH-AFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDPTDRGTIIIFGD 159 Escherichia coli E24377A
O34746  81 VTPDQ-SFPTVSCMIQEQLGAKKACAMDISAACAGFMYGVVTGKQFIESGTYKHVLVVGVEKLSSITDWEDRNTAVLFGD 159 Bacillus subtilis sub...
O84242  81 AAPDY-IFPSSAALAQAYLGIKEIPAFDCLAACTGFLYGLSIAKAYVESGMYQCVLVIAADKLSSFVNYQDRNTCVLFGD 159 Chlamydia trachomatis...
P24249  81 TSATH-AFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYVKSGAVKYALVVGSDVLARTCDPTDRGTIIIFGD 159 Escherichia coli
P43711  81 TSHSH-AYPSAACQVQGLLNIDDAISFDLAAACTGFVYALSVADQFIRAGKVKKALVIGSDLNSRKLDETDRSTVVLFGD 159 Haemophilus influenza...
O24994  83 LSPDFlAMPSTACVLSAKLGIENKPAFDISAACTGFIYLLSVAKAYVESGMYENVLIVGAEKTSSVLDFKDRGTCILFGD 162 Helicobacter pylori 2...
Q9ZCH1  81 TTPDN-SFPSVATKLHGYLGLTNIPSFDLQAVCAGFIYGLQLAHSLIVSGKYKTILLIGAEKMTSLLDWNDRSTCVLFGD 159 Rickettsia prowazekii...
O06399  91 NTHFL-QTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDMYDRGNCFIFAD 169 Mycobacterium tubercu...
Q9Z8P0  89 AAPDY-IFPSSGALAQAHLGIEDVPTFDCQAACTGYLYGLSVAKAYVESGTYNHVLLIAADKLSSFVDYTDRNTCVLFGD 167 Chlamydia pneumoniae
3IL3_A  88 TSHSH-AYPSAACQVQGLLNIDDAISFDLAAAXTGFVYALSVADQFIRAGKVKKALVIGSDLNSRKLDETDRSTVVLFGD 166 Haemophilus influenzae
1M1M_A 111 NTHFL-QTPPAAPMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDMYDRGNCFIFAD 189 Mycobacterium tubercu...
1HN9_A 160 GAGAAVLAASEePG---IISTHLHADGSYGELLTLPnadrv-------npensIHLTMAGNEVFKVAVTELAHIVDETLA 229 Escherichia coli E24377A
O34746 160 GAGAAVVGPVSdDRg--ILSFELGADGTGGQHLYLNe---------------kRHTIMNGREVFKFAVRQMGESCVNVIE 222 Bacillus subtilis sub...
O84242 160 GGSACIVGHSR-PGaleISKVNLGADGKQGDLLRLPaggsrcpasqdtvqnhqHFITMEGKEVFKHAVRRMEFAAKTCIT 238 Chlamydia trachomatis...
P24249 160 GAGAAVLAASEePG---IISTHLHADGSYGELLTLPnadrv-------npensIHLTMAGNEVFKVAVTELAHIVDETLA 229 Escherichia coli
P43711 160 GAGAVILEASEqEG---IISTHLHASADKNNALVLAqperg--------ieksGYIEMQGNETFKLAVRELSNVVEETLL 228 Haemophilus influenza...
O24994 163 GAGACVIGRTKrLKe-sILDVQISANGNFSNYLYTPrtlkptpf-nakeeasePFLCMKGNEVFKLAVKTLLKDVEMILE 240 Helicobacter pylori 2...
Q9ZCH1 160 GAGSVILQRSNdDSg--LIDSNIFSSGTDYEILYTSggtsm--------ngtsGKIVMQGQKLFRHAIEKMLQSIEDLLY 229 Rickettsia prowazekii...
O06399 170 GAAAVVVGETPfQG---IGPTVAGSDGEQADAIRQDidwitfa---qnpsgprPFVRLEGPAVFRWAAFKMGDVGRRAMD 243 Mycobacterium tubercu...
Q9Z8P0 168 GGAACVIGESR-PGsleINRLSLGADGKLGELLSLPaggsrcpasketlqsgkHFIAMEGKEVFKHAVRRMETAAKHSIA 246 Chlamydia pneumoniae
3IL3_A 167 GAGAVILEASEqEG---IISTHLHASADKNNALVLAqperg--------ieksGYIEMQGNETFKLAVRELSNVVEETLL 235 Haemophilus influenzae
1M1M_A 190 GAAAVVVGETPfQG---IGPTVAGSDGEQADAIRQDidwitfa---qnpsgprPFVRLEGPAVFRWAAFKMGDVGRRAMD 263 Mycobacterium tubercu...
1HN9_A 230 ANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDR-H-GNTSAASVPCALDEAVRDGRIKPGQLVLLEAFGGG 307 Escherichia coli E24377A
O34746 223 KAGLSKEDVDFLIPHQANIRIMEAARERLELPVEKMSKTVHK-Y-GNTSAASIPISLVEELEAGKIKDGDVVVMVGFGGG 300 Bacillus subtilis sub...
O84242 239 EAGLQEKDIDWLVPHQANERIIDAIAKRFAVKDSRVFKTLAK-Y-GNTAASSVGIALDELLRTHDIHVAERLLLVAFGGG 316 Chlamydia trachomatis...
P24249 230 ANNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDR-H-GNTSAASVPCALDEAVRDGRIKPGQLVLLEAFGGG 307 Escherichia coli
P43711 229 ANNLDKKDLDWLVPHQANLRIITATAKKLEMDMSQVVVTLDK-Y-ANNSAATVPVALDEAIRDGRIQRGQLLLLEAFGGG 306 Haemophilus influenza...
O24994 241 KNALKPEDVRLFIPHQANFRIIQAVREHLDFKDEQVVLTVHK-Y-GNTSAASIPMAMGEAYEEGRLKKGDLMLLDAFGGG 318 Helicobacter pylori 2...
Q9ZCH1 230 ANQFSVSDIDYFIPHQANIRIINKLAELLNIEEHKVVKTVEK-H-ANCSAASIPLALSALKESGKIKKGDILLFSAIGAG 307 Rickettsia prowazekii...
O06399 244 AAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANDIEhT-GNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAG 322 Mycobacterium tubercu...
Q9Z8P0 247 LAGIQEEDIDWFVPHQANERIIDALAKRFEIDESRVFKSVHK-Y-GNTAASSVGIALDELVHTESIKLDDYLLLVAFGGG 324 Chlamydia pneumoniae
3IL3_A 236 ANNLDKKDLDWLVPHQANLRIITATAKKLEMDMSQVVVTLDK-Y-ANNSAATVPVALDEAIRDGRIQRGQLLLLEAFGGG 313 Haemophilus influenzae
1M1M_A 264 AAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANDIE-HtGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAG 342 Mycobacterium tubercu...
1HN9_A 308 FTWGSALVRF 317 Escherichia coli E24377A
O34746 301 LTWGAIAIRW 310 Bacillus subtilis subsp. subtilis str. 168
O84242 317 LSWGAVILQQ 326 Chlamydia trachomatis D/UW-3/CX
P24249 308 FTWGSALVRF 317 Escherichia coli
P43711 307 WTWGSALVRF 316 Haemophilus influenzae Rd KW20
O24994 319 LTWGSALVYF 328 Helicobacter pylori 26695
Q9ZCH1 308 LTWGGALIRW 317 Rickettsia prowazekii str. Madrid E
O06399 323 LSYAAQVVRM 332 Mycobacterium tuberculosis
Q9Z8P0 325 LSWGAVVLKQ 334 Chlamydia pneumoniae
3IL3_A 314 WTWGSALVRF 323 Haemophilus influenzae
1M1M_A 343 LSYAAQVVRM 352 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap