1BGX


Conserved Protein Domain Family
pola

?
TIGR00593: pola (this model, PSSM-Id:161944 is obsolete and has been replaced by 273160)
Click on image for an interactive view with Cn3D
DNA polymerase I
All proteins in this family for which functions are known are DNA polymerases Many also have an exonuclease motif. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair].
Statistics
?
PSSM-Id: 161944
View PSSM: TIGR00593
Aligned: 13 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 11-Sep-2012
Updated: 15-Oct-2012
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BGX_T        14 VLLVDGHHLAYRTFHAL-Kg-----LTTSRGEPVQAVYGFAKSLLKALKEDG--DAVIVVFDAKAPSFRHEAYGGYKAGR 85
gi 62298349   14 VLLVDGHHLAYRTFFAL-Kg-----LTTSRGEPVQAVYGFAKSLLKALKEDGy-KAVFVVFDAKAPSFRHEAYEAYKAGR 86
gi 290068     14 LVLIDGHALAFRSYFAL-Pp-----LNNSKGEMTDAIVGFMKLLLRLARQKS--NQVIVVFDPPVKTLRHEQYEGYKSGR 85
gi 146345413   7 LLLIDGSSVAFRAFFAL-Ynql-drFKAPNGLHTNAIFAFHTMLSSLMERIQp-THVLIAFDAGKTTFRTEMFADYKGGR 83
gi 1169403    18 LMLLDGNSLAFRAFYAL-Pte---nFKTRGGLTTNAVYGFTAMLINLLREEAp-THIAAAFDVSRKTFRSECYAGYKANR 92
gi 226693519   3 LVIFDGNSILYRAFFAL-Pe-----LTTSNNIPTNAIYGFVNVILKYLEQEKp-DYVAVAFDKRGREARKSEYEEYKANR 75
gi 6015002     6 LVLVDGHALAYRAFFAL-Res---gLRSSRGEPTYAVFGFAQILLTALAEYRp-DYAAVAFDVGR-TFRDDLYAEYKAGR 79
gi 6225284     4 LYLIDALNIIFRNYHVM-Kny---pLLNTQGENVNAFIGFFKTLFFIIKEKNp-EHLIITFDSEVPTFRKQKYPSYKATR 78
gi 6225285    10 LLLVDGHSLAFRAYYAF-GlskkgpLRTTAGIPTSVCFGFLNSLMQVMESQKp-AAIAIAFDRREPTFRHEADGAYKSNR 87
gi 6015004     7 LLLIDGYGFVFRAYYAQ-Ks-----LSSAKGEPVGALYGFTSMLLKLLSDFKp-QYVAIVFDSGGKNFRHKIYQNYKANR 79
gi 416913      5 LVLIDGSSVAYRAFFAL-Pl-----LHNDKGIHTNAVYGFTMMLNKILAEEEp-THMLVAFDAGKTTFRHEAFQEYKGGR 77
gi 6166143     7 LYLLDAYGLIYRSYHAF-Ara---pLINDSGANVSAVYGFFRSLHTLLCHYRp-RYFVAVFDSLTPTFRHVQYPAYKAKR 81
gi 15646079   12 LALIDTFAYLFRSYYMSaKnk---pLTNDKGFPTGLLTGLVGMVKKFYKDRKnmPFIVFALESQTKTKRAEKLGEYKQNR 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BGX_T        86 APTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKE--GYEVRILTADKDLYQLLSD--RIHVLHPeg- 160
gi 62298349   87 APTPEDFPRQLALIKELVDLLGFTRLEVPGYEADDVLATLAKKAEKE--GYEVRILTADRDLYQLVSD--RVAVLHPeg- 161
gi 290068     86 AQTPEDLRGQINRIRALVDALGFPRLEEPGYEADDVIASLTRMAEGK--GYEVRIVTSDRDAYQLLDE--HVKVIANdf- 160
gi 146345413  84 SKTPDEFREQLPFIKEMIEKLGIRHYELANYEADDIIGTLDKMAEAPdvNFDVTIVTGDKDMIQLVDG--NTRVEISkkg 161
gi 1169403    93 SSIPAEFHGQIDITKEVLGALGITVFAEAGFEADDLIATLATQAENE--GYRVLVVTGDRDALQLVSN--DVTVLYPrkg 168
gi 226693519  76 KPMPDNLQVQIPYVREILYAFNIPIIEFEGYEADDVIGSLVNQFKNT--GLDIVIITGDRDTLQLLDK--NVVVKIVstk 151
gi 6015002    80 AETPEEFYPQFERIKQLVQALNIPIYTAEGYEADDVIGTLARQATER--GVDTIILTGDSDVLQLVND--HVRVALAnpy 155
gi 6225284    79 DLPPDDLIPQIGWIKEGLLKAKIPIFEMEGYEADDLLASFAKKAAKN--NYLTYIISPDKDLLQTMSE--YVKILKIenn 154
gi 6225285    88 QETPEDFAEDLSYLQQLLEALNLQTITYAGYEADDILGTLACQGSDA--GYQVKILSGDRDLFQLVSPekNISVLYLtrn 165
gi 6015004    80 PLPPKDLIAQLPLVRDVASNFKFAILEKNGYEADDIIATFATKTVSL--GEEVIIISSDKDLLQLMSK--NIKIYDPik- 154
gi 416913     78 QQTPPELSEQFPLLRELLRAYRIPAYELENYEADDIIGTLAARAEQE--GFEVKVISGDRDLTQLASP--HVTVDITkkg 153
gi 6166143    82 DKTSAELYAQIPLIEEILCALGITVLRHDGFEADDLIATLAKRVAAE--HCHVVIISSDKDVLQLVCD--TVQVLRLdid 157
gi 15646079   89 KDAPKEMLLQIPIALEWLQKMGFVCVEVNGFEADDVIASLATLSP-----YKTRIYSKDKDFNQLLSD--KIALFDGk-- 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BGX_T       161 --------yLITPAWLWEKY-GLRPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLK------------ 219
gi 62298349  162 --------hLITPEWLWEKY-GLRPEQWVDFRALVGDPSDNLPGVKGIGEKTALKLLKEWGSLENLLK------------ 220
gi 290068    161 --------sLIGPAQVEEKY-GVTVRQWVDYRALTGDASDNIPGAKGIGPKTAAKLLQEYGTLEKVYEa----------a 221
gi 146345413 162 v----aefeEFTPDYLLEKM-GLTPSQFIDLKALMGDSSDNYPGVTKVGEKTGLKLLQEFGSLENLYE------------ 224
gi 1169403   169 v----seltRFTPEAVIEKY-GVTPAQYPDLAALRGDPSDNLPGIPGVGEKTAAKWIVDYGSLQGLVD------------ 231
gi 226693519 152 fd--ktvedLYTVENVKEKY-GVWANQVPDYKALVGDQSDNIPGVKGIGEKSAQKLLEEYSSLEEIYQ------------ 216
gi 6015002   156 gg--ktsvtLYDLEQVRKRYdGLEPDQLADLRGLKGDTSDNIPGVRGIGEKGAIALLKQFRSLDALLE------------ 221
gi 6225284   155 ------sfiEMDNEYVTKKF-GVNSFQIKDYLAIVGDRSDNIPGIKGIGAKGAANLLREFKTLDGIYS------------ 215
gi 6225285   166 pfssntgydELDWQGVVDKM-GVTPAQIVDFKALCGDKSDCIPGINGIGEKTAIKLLAEYETLEKVYE------------ 232
gi 6015004   155 -------ckYITEDNVVTKF-GTTPDKLREVMALIGDRSDNIPGVPSIGPKTASSLITKFGSVENIFN------------ 214
gi 416913    154 i----tdiePYTPEAVREKY-GLTPEQIVDLKGLMGDKSDNIPGVPGIGEKTAVKLLRQFGTVENVLA------------ 216
gi 6166143   158 h-----kwtCCDAAYVQQRW-TVMPTQLLDLFSLMGDSSDNVPGVRGIGPKTAAHLLHCFGTLDGIYRhtyslkealrtk 231
gi 15646079  160 --------tEFLAKDCVEKY-GILPSQFTDYQGIVGDSSDNYKGVKGIGSKNAKELLQRLGSLEKIYE------------ 218
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BGX_T       220 NLD---RLKPA-IREKILAHMDDLKL---SWDLAKVRTDLPLEVDFa---KRREPDRERLRA-FLERLEFGSLLHEFGLL 288
gi 62298349  221 NLD---RVKPEnVREKIKAHLEDLRL---SLELSRVRTDLPLEVDLa---QGREPDREGLRA-FLERLEFGSLLHEFGLL 290
gi 290068    222 HAG---TLKPDgTRKKLLDSEENVKF---SHDLSCMVTDLPLDIEFg---VRRLPDNPLVTEdLLTELELHSLRPMILGL 292
gi 146345413 225 NVE---TLKASkMKDNLIADKEMAFL---SQQLATINTKAPLEIGLed-tLLKEKNVAELGQ-FYDEMGFSQFKSKLLAD 296
gi 1169403   232 NVE---SVRGk-VGEALRTHLASVVR---NRELTELVKDVPLVQTSdt-lRLQPWDRDRIHR-LFDNLEFRVLRDRLFEA 302
gi 226693519 217 NLD---KIKSs-IREKLEAGKDMAFL---SKRLATIVCDLPLNVKLed-lRTKEWNKERLYE-ILVQLEFKSIIKRLGLS 287
gi 6015002   222 QID---AAPKr-YQTLLREQAEAARF---SRQLATIVTDVPVQLDLea-aRIGVYDRSAVMA-LFQELEFGVSSNLIKKL 292
gi 6225284   216 NLE---IINKk-HRELLIKEKENAFL---SYELVSLEENLKIPEIEnfalKNFSEEIISLFEkHSAIALIKTYKKDILKQ 288
gi 6225285   233 NLA---QIKGa-LKTRLDNGKDDAMH---SQMLARIVVDVPLPVTWed-lQLTGFSTDRLVP-LLEKLELRTFIDKIQAF 303
gi 6015004   215 SLD---QISSIkQRKTLQNAREAALI---SWKLIGLDSNVDLDFDLnn-lKWSPPNSKKLTG-FLQEYGFKSLYKRVENL 286
gi 416913    217 SID---EIKGEkLKETLRQHREMALL---SKKLAAIRRDAPVELSLdd-iAYQGEDREKVVA-LFKELGFQSFLEKME-- 286
gi 6166143   232 IVC---GKKDAfFSRSLIELRDDVPCvfsLEDSCCIPLDVTSAARIf--vREGLHALAQQYRaCVQEIDTEATNDTLQMT 306
gi 15646079  219 NLDlakNLLSPkMYRALIHDKASAFL---SKELATLERGCIKEFDFlscaFPSENPLLKIKD-ELKEYGFISTLRDLENS 294
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BGX_T       289 ESPk------------------------------ALEEAPWP-PPEGAFVG-----------FVLSRKEPMWADLLALAA 326
gi 62298349  291 EAPa------------------------------PLEEAPWP-PPEGAFVG-----------FVLSRPEPMWAELKALAA 328
gi 290068    293 NGPeqdghapddllerehaqtpeedeaaalpafsAPELAEWQtPAEGAVWG-----------YVLSREDDLTAALLAAAT 361
gi 146345413 297 GGGevtdetvse----------------eikfeivtDKSSVAsVNADDf-------------FYLETLGENYHREQIVAF 347
gi 1169403   303 LAAagervpevd-------------egfdvrgglLESGTVGRwLAKHADDGrrs------glAIVGTHLPHGGDATALAV 363
gi 226693519 288 evvqf---------------------------efvqQRTDIPdVEQKE----------------LESISQIRSKEIPLMF 324
gi 6015002   293 PSVvqaptlaelpadlpaaplttaptqlslfageSEPAQPTAePPPVTIVRd---------aTALADLVSRLRNAPAFAF 363
gi 6225284   289 EKEnadqkslfk-------------qepttnsldDINTIDTEnVKYRSITTk----------IELDDLIESLKKAKYISI 345
gi 6225285   304 HRNfsdnqspvpmgnea----dngepkktvkakkSKEKVNPDdSQQLSLFDgvpvv-nqedgLITIQLPKQIQPQIITTI 378
gi 6015004   287 FDIkindheeiv-------------dnkvteakeISNASELAnFAKEAERIg----------IFGIYLLQQKGENRALIL 343
gi 416913    287 -SPsseeekpl-----------------akmaftlaDRVTEEmLADKAa-------------LVVEVVEENYHDAPIVGI 335
gi 6166143   307 ESSvltsgrcanecflsqvegrastpevnsvlksELKTSAVSgAIPIENRDlrqdvmlarsaGHYRGVTDPVELKRIIDC 386
gi 15646079  295 PTPlildnaplldntp-----aldntpkkscmivLESAAPLSaFLEKLEKTna--------rVFARLVLDKEKKVLALAF 361
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BGX_T       327 ARGg----RVHRAPEP----------------------------------YKALRDLKEARGLL---------------- 352
gi 62298349  329 CRDg----RVHRAADP----------------------------------LAGLKDLKEVRGLL---------------- 354
gi 290068    362 FEDgv--aRPARVSEPdewaqaeapenlfgel---lpsdkpltkkeqkalEKAQKDAEKARAKLreqfpatvdeaefvgq 436
gi 146345413 348 AWGn---sEKIYVSKN----------------------------------LDLLTEMKFP---Ent-------------- 373
gi 1169403   364 AAAd---gNGGYIDTAm---------------------------------LTPDDDDALAAWLAdpdnp----------- 396
gi 226693519 325 VQGe---kCFYLYDQEsn-------------------------------tVFITSNKLLIEEILksdtv----------- 359
gi 6015002   364 DTEct--sLQPVASDLvgisiaiap----------------dtvcyipvgHQSETQVPCGEVVTalapffanp------q 419
gi 6225284   346 DTEts--sLDTYTAKLigisis----------------------fkefegYYIPIEAKGKIYIEknyiiqkfnnl-fesn 400
gi 6225285   379 AQLealveELKKHTDAdfpvawdtetdsldplvanlvgigcawgqepnqvAYIPLKHHQGEQLSlgiikdllgeilgnai 458
gi 6015004   344 SLQnq--sYIIKITNNn--------------------------------yNIKNNNDWFSHIILnlltnk---------- 379
gi 416913    336 AVVn---eHGRFFLRP----------------------------------ETALADPQFVAWLGdetkk----------- 367
gi 6166143   387 ACAn---gVVAFDCETdglhphdtrlvgfsicfqeaeafyvplivpdvslHTESTQCTCARSTNvetekecteqhgvsas 463
gi 15646079  362 LYEdq--gYFLPLEEAlfs-----------------------------pfSLEFLQNAFFKMLQhaqi------------ 398
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BGX_T       353 -------AKDLSVLALREGLGLP---PGDDPMLLAYLLDPSNTt--PEGVARRYGG------------------------ 396
gi 62298349  355 -------AKDLAVLASREGLDLV---PGDDPMLLAYLLDPSNTt--PEGVARRYGG------------------------ 398
gi 290068    437 rtvtaaaAKALAAHLSVRGTVVE---PGDDPLLYAYLLDPANTn--MPVVAKRYLDr----------------------- 488
gi 146345413 374 -----ydFKKNRVLLSHLNIELPl--VKFDAMLAKYLISTTEDn-kISTIARLFDVghlatdeeifg----kgtklalpd 441
gi 1169403   397 --kalheAKLAMHDLAGRGWTLGg--ITSDTALAAYLVRPGQRsftLDDLSLRYLRrelraetpeqeq--fslldnvdev 470
gi 226693519 360 --kimydLKNIFHQLNLEDTNNIk--NCEDVMIASYVLDSTRSsyeLETLFVSYlntdie-------------------- 415
gi 6015002   420 qpkfahnAKFDMEVLAGAGIKVSg--LAFDTMIAAAMLGKRQGlkdLAFYELKLPEppttiedligrg--nkqisfaevp 495
gi 6225284   401 pkiigqnYKFDYKILKNNGFNPIp--PYFDTMIAAYLIDTNSKv-sLDFLAEKYLMhknikyedviq----kndnfanis 473
gi 6225285   459 ypkvlqnAKFDRRVLAHHGIELGg--VVLDTMLASYVLQPEETh-nLTDLCRRYNLglvalsykdlgl--kkdqtiadlp 533
gi 6015004   380 --sikkiTYSLKHLLKFYANQSHqitAIEDLELMQYALSAGLVqknLFTKTLTKDN------------------------ 433
gi 416913    368 --ksmfdSKRAAVALKWKGIELCg--VSFDLLLAAYLLDPAQGvddVAAAAKMKQYeavrpdeavyg----kgakravpd 439
gi 6166143   464 avqdpayVQAVMHQLRRLWNDETltlVMHNGKFDYHVMHRAGVfehCACNIFDTMVaawlldpdrgtygmdvlaasffqi 543
gi 15646079  399 ---ighdLKPLLSFLKAKYQVPLeniRIQDTQILAFLKNPEKVg--FDEVLKEYLKeeliphek----------ikdfkt 463
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BGX_T       397 --EWTEEAGERAALSERLFANLWGRLEg------------------EERLLWLYREVERPLSAVLAHMEATGVRLDVAYL 456
gi 62298349  399 --EWTEDAAHRALLSERLHRNLLKRLEg------------------EEKLLWLYHEVEKPLSRVLAHMEATGVRLDVAYL 458
gi 290068    489 --EWPADAPTRAAITGHLVRELPPLLD--------------------DARRKMYDEMEKPLSGVLGRMEVRGVQVDSDFL 546
gi 146345413 442 deILFDHLARKIRVLARAKEKMMAELI-------------------ENEQEHLLSDMELPLAEVLAKMEITGISVSQNTL 502
gi 1169403   471 dkQAIQTLILRARAVVDLAAALDAELD-------------------LIDSTSLLGEMELPVQQVLADMEKAGIAADLRLL 531
gi 226693519 416 -avkkdKKIVSVVLLKRLWDELLRLID-------------------LNSCQFLYENIERPLIPVLYEMEKTGFKVDRDAL 475
gi 6015002   496 veQAAPYAAADALYTLRLTERLQRQLEa------------------EPALHDLYYRVELPLIEVLTDMELTGIRLDQEYL 557
gi 6225284   474 leMATSYSSEDADITFRLFNIFTKKLK-------------------EDKLDKLMHEIEMPFNKVIIEMEENGIYLDKEYL 534
gi 6225285   534 leTAGQYCGLDCYATYLLASKLQKELDq------------------YPELKEILKEIEQPLEKILAAMEDRGIRIDCDYL 595
gi 6015004   434 ---IINESARIVINFISLYKQTLLELQ-------------------KNKAFRLYREIDLPTCFILDKMEKVGIKVDANYL 491
gi 416913    440 epVLAEHLVRKAAAIWALERPFLDELR-------------------RNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRL 500
gi 6166143   544 rtITFEEVVAKGQTFAHVPYECAVRYAaedaditfrlyhylklrleTAGLLSVFETIEMPLLPILARMEEVGIFLRKDVV 623
gi 15646079  464 kaEKLELLSVELNALKRLCEYFEKGGL-------------------EENLLSLAREIETPFMKVLMGMEFQGFKIDAPYF 524
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BGX_T       457 RALSLEVAEEIARLEAEVFRLAGHPFNLNSRDQLERVLFDELGLPAiG----KTEKTGkRSTSAAVLEALREa--HPI-V 529
gi 62298349  459 QALSLELAEEIRRLEEEVFRLAGHPFNLNSRDQLERVLFDELRLPA-Lg---KTQKTGkRSTSAAVLEALREa--HPI-V 531
gi 290068    547 QTLSIQAGVRLADLESQIHEYAGEEFHIRSPKQLETVLYDKLELAS-Sk---KTKLTGqRSTAVSALEPLRDa--HPI-I 619
gi 146345413 503 EEIGAENEEKLASLTREIYDLAGEEFNINSPKQLGVILFEKLQLPV-G----KKTKTG-YSTAVDVLEDLAAl--SPV-V 573
gi 1169403   532 TELQSQFGDQIRDAAEAAYAVIGKQINLSSPKQLQVVLFEELGMPK-T----KRTKTG-YTTDADALQSLFCkteHPF-L 604
gi 226693519 476 IQYTKEIENKILKLETQIYQIAGEWFNINSPKQLSYILFEKLKLPV-I----KKTKTG-YSTDAEVLEELFDk--HEI-V 546
gi 6015002   558 RELGRHFAQRIADLVERIYQQAGGPFNINSGQQLNDVLFGRLGIDP-RahglSKLKSGgYSITAEVLEELS----QLYpI 632
gi 6225284   535 KEYGKELGKELEAIENEIIKSIGIDFNLNSPKQMHEILFEKLNLKL-P----EKMKKD--STDIKVLESLREq--HES-- 603
gi 6225285   596 QTLSQQLAENLLTIETAAYEAAGESFNLSSPKQLGTILFDKLGLDR-Kk--sRKTKTG-YSTDHATLEKLQGd--HP--I 667
gi 6015004   492 NRLSDEFGTEILKIEEEIFALSGTKFNIGSQKQLGEILFKKMQLPS-Gn---TLAKTSsYSTRAGILKKLSE---DGYhI 564
gi 416913    501 EQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPV-L----KKSKTG-YSTSADVLEKLAPy--HEI-V 571
gi 6166143   624 QQLTRSFSDLIQQYEHDIFSLAGHEFNIGSPKQLQTVLFQELHLPP-G----KKNTQG-YSTDHSVLKKLAR---KHP-I 693
gi 15646079  525 KRLEQEFKNELHVLERQILELIGVDFNLNSPKQLSEVLYDKLGLP--------KNKS--HSTDEKSLLKILDk--HPS-I 591
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BGX_T       530 EKIL-QYRELTKLKSTyIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA-E----EG 603
gi 62298349  532 EKIL-QHRELTKLKNTyVDPLPSLVHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFVA-E----AG 605
gi 290068    620 PLVL-EFRELDKLRGTyLDPIPNLVNPHTGRLHTTFAQTAVATGRLSSLNPNLQNIPIRSELGREIRKGFIA-E----DG 693
gi 146345413 574 AKIL-EYRQINKVQSTyVKGLIPQIADD-GKIHTRYVQDLTQTGRLSSVDPNLQNIPVRLEEGRKIRKAFVP-S----QD 646
gi 1169403   605 QHLL-THRDVTRLKVT-VDGLLNAVAAD-GRIHTTFNQTIATTGRLSSTEPNLQNIPIRTNAGRQIRDAFVV-GsennGY 680
gi 226693519 547 PLIL-DYRMYTKILTTyCQGLLQAINPSSGRVHTTFIQTGTATGRLASSDPNLQNIPVKYDEGKLIRKVFVP-E----GG 620
gi 6015002   633 AADIlTYRQLTKLKSTyIDALPDLVNPRTGRIHTSYNQLGAATGRLSSNNPNLQNIPVRTEEGREIRRAFVA-Ep----G 707
gi 6225284   604 IENLiKYRQIAKLKSTyTDNLIELINYKTNRLHTSFIQTKTATGRITSINPNLQNIPIKDEKGRKIRKAFKP-E----NG 678
gi 6225285   668 IDAIlEHRTLAKLKSTyVDALPELVNGQTQRIHTDFNQAVTSTGRLSSSNPNLQNIPIRSDFSRQIRRAFLP-Q----KD 742
gi 6015004   565 ATLLlRWRQLTKLKNTyTDSLPKQINNITKRIHTTFLQTSTTTGRLSSQEPNLQNVPIRSSDGNKIREAFIA-E----EG 639
gi 416913    572 ENILqHYRQLGKLQSTyIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPsE----SD 647
gi 6166143   694 AEKIlLFRDLSKLRST-YTESLAKLADQTGRVHTSFVQIGTATGRLSSRNPNLQNIPIKSTEGRKIRQAFQA-T----VG 767
gi 15646079  592 ALIL-EYRELNKLFNTyTTPLLRLKDKD-DKIHTTFIQTGTATGRLSSHSPNLQNIPVRSPKGLLIRKGFIAsS----KE 665
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BGX_T       604 WLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPR-EAVDPLMRRAAKTINFGVLYGMSAHRLSQEL 682
gi 62298349  606 WALVALDYSQIELRVLAHLSGDENLIRVFQEGKDIHTQTASWMFGVPP-EAVDPLMRRAAKTVNFGVLYGMSAHRLSQEL 684
gi 290068    694 FTLIAADYSQIELRLLAHIADDPLMQQAFVEGADIHRRTAAQVLGLDE-ATVDANQRRAAKTVNFGVLYGMSAHRLSNDL 772
gi 146345413 647 SLLLSSDYSQIELRVLAHISADEHLIDAFKHGADIHTSTAMRVFGIEKaEDVTANDRRNAKAVNFGVVYGISDFGLARNL 726
gi 1169403   681 TELMTADYSQIEMRIMAHLSRDEGLIEAFHTGEDLHSFVASRAFGIPI-EDITPELRRRVKAMSYGLAYGLSAYGLATQL 759
gi 226693519 621 HVLIDADYSQIELRILAHISEDERLISAFKNNVDIHSQTAAEVFGVDI-ADVTPEMRSQAKAVNFGIVYGISDYGLARDI 699
gi 6015002   708 WRFVAADYSQIELRVLAHMSGDENLIAAFQQGLDIHAATASRLFGVEP-TAVDKNQRRVAKTVVFGVIYGISAFGLAQRL 786
gi 6225284   679 NIFISADYSQIELAILAHLSQDEVLIKAFENNKDIHTETASKLFKIEE-KEITPNLRRIAKSINFGIIYRMSDFRLAKEL 757
gi 6225285   743 WLLVSADYSQIELRILAHLSQEPVLLQAYGDRQDVHGVTAKLLFGK---EDITPAERNLGKTINFGVIYGMGAQRFARET 819
gi 6015004   640 YKLISADYSQIELRILSHIANIDVLKQAFINKEDIHTQTACQIFNLKK-HELTSEHRRKAKAINFGIIYGISAFGLAKQL 718
gi 416913    648 WLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSE-DEVTPNMRRQAKAVNFGIVYGISDYGLAQNL 726
gi 6166143   768 HELISADYTQIELVVLAHLSQDRNLLNAFRQHIDIHALTAAYIFNVSI-DDVQPAMRRIAKTINFGIVYGMSAFRLSDEL 846
gi 15646079  666 YCLLGVDYSQIELRLLAHFSQDKDLMEAFLKGRDIHLETSKALFG----EYLAKEKRSIAKSINFGLVYGMGSKKLSETL 741
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BGX_T       683 AIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREA------------------A 744
gi 62298349  685 AIPYEEAVAFIERYFQSFPKVRAWIEKTLEEGRKRGYVETLFGRRRYVPDLNARVKSVREA------------------A 746
gi 290068    773 GIPYAEAATFIEIYFATYPGIRRYINHTLDFGRTHGYVETLYGRRRYVPGLSSRNRVQREA------------------E 834
gi 146345413 727 GITRKDAKNYIETYFERYPGIKTYMENIVREARDKGFVETMSHRRRKIPDINARNFNVRGF------------------A 788
gi 1169403   760 KISTEEAKLQMEQYFARFGGVRDYLMDVVEQARKDGYTSTVLGRRRYLPELDSSNRQIREA------------------A 821
gi 226693519 700 KISRKEAAEFINKYFERYPKVKEYLDNTVKFARDNGFVLTLFNRKRYIKDIKSTNRNLRGY------------------A 761
gi 6015002   787 GIERDLARQLIDNLFAQFPGIRRYIDQTLEFGRQHGYVQTLFGRRRVMEDLR-ASGARRAA------------------A 847
gi 6225284   758 GITKEEAKGFINSYFDSYPKIKEFIINQINFVRNAGYSETILKRRRYIKEINSNNYLERSA------------------A 819
gi 6225285   820 GISAVEGREFIDRYHRTYAQVFDYLETMKLEAIAKGYVTTIVGRRRYFNFVTEALRQLRGKtvteldlvdvkmnyndaqL 899
gi 6015004   719 NVSNSTASEYIKQYFAEYKGVQEYMTQTKACASRNGYVTNFFGRKCFIPLIH--DKKLKQF------------------A 778
gi 416913    727 NISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSF------------------A 788
gi 6166143   847 KISQKEAQSFIYRYFETYPGVYAFSTQVAEQTRKTGYVTSLAGRRRYIRTIDSRNTLERAR------------------A 908
gi 15646079  742 NISLNEAKSYIEAYFKRFPSIKDYLNRMKEEILKTSKAFTLLGRYRVFDFTGANDYVKGNY------------------- 802
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1BGX_T       745 ERMAFNMPVQGTAADLMKLAMVKLFPRLEEMG--ARMLLQVHDELVLEAPKERAEAVARLAKEVME-GVYPLA-VPLEVE 820
gi 62298349  747 ERMAFNMPVQGTAADLMKLAMVKLFPRLREMG--ARMLLQVHDELLLEAPQARAEEVAALAKEAME-KAYPLA-VPLEVE 822
gi 290068    835 ERLAYNMPIQGTAADIMKLAMVQLDPQLDAIG--ARMLLQVHDELLIEAPLDKAEQVAALTKKVME-NVVQLK-VPLAVE 910
gi 146345413 789 ERTAINSPIQGSAADILKIAMINLDKALTERQskSKLLLQVHDEIILDVPLEELEDIKALVKQTME-EAIELA-VPLKVD 866
gi 1169403   822 ERAALNAPIQGSAADIIKVAMIAVDKSLKQAKlaSRMLLQVHDELLFEVAIGEREQIEAMVREQMG-SAYPLD-VPLEVS 899
gi 226693519 762 ERIAMNSPIQGSAADIMKLAMIKVYQKLKENNlkSKIILQVHDELLIEAPYEEKDIVKEIVKREME-NAVALK-VPLVVE 839
gi 6015002   848 EREAINAPIQGTAADLMKMAMVNVHRALREQGlrTRLLLQVHDELIAEAPEDEVEPAARLLRDVMS-SVYRDLvVPLSVN 926
gi 6225284   820 ERIAINSIIQGSAADIMKIAMVKVFNEFKSKKmeSKILLQVHDEMLIESPIEEENEVKKILKIMME-TAYTLN-LPLRAN 897
gi 6225285   900 LRSAANAPIQGSSADIIKIAMVKLAKLLESYQ--TRMLLQVHDELIFEMPPEEWEELAPLIQNTME-QALTLS-VPLVVE 975
gi 6015004   779 ERAAINAPIQGTNADIIKIAMIKLDKEIEERKlkTRLILQIHDELLFEVPEIEVEIVIPIIKKIME-HSTNMN-VPIITE 856
gi 416913    789 ERMAMNTPIQGSAADIIKKAMIDLNARLKEERlqARLLLQVHDELILEAPKEEMERLCRLVPEVME-QAVTLR-VPLKVD 866
gi 6166143   909 ERMALNTQIQSSAADIVKIAMIAIQRAFARRPlrAQLLLQVHDELIFEAPAAETAIVKEILFAEME-HAVELS-IPLRIH 986
gi 15646079  803 LREGVNAIFQGSASDLLKLGMLKVSERFKNNPs-VRLLLQVHDELIFEIEEKNAPELQQEIQRILNdEVYPLR-VPLETS 880
                       1050
                 ....*....|.
1BGX_T       821 VGIGEDWLSAK 831
gi 62298349  823 VGMGEDWLSAK 833
gi 290068    911 VGTGPNWFDTK 921
gi 146345413 867 DNTGKTWYEAK 877
gi 1169403   900 VGFGRSWGAAA 910
gi 226693519 840 VKEGLNWYETK 850
gi 6015002   927 LEVGPNWDEMS 937
gi 6225284   898 IETGKSWGEIH 908
gi 6225285   976 MHRGSNWMEAK 986
gi 6015004   857 IKAGNNWKEIH 867
gi 416913    867 YHYGSTWYDAK 877
gi 6166143   987 VESGNSWGDFH 997
gi 15646079  881 AFIAKRWNELK 891
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap